Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X7K6

Protein Details
Accession A0A0C9X7K6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-82RTQPILEEKKPRPKPRPLKRGNKKDBasic
NLS Segment(s)
PositionSequence
65-82EKKPRPKPRPLKRGNKKD
Subcellular Location(s) cyto 11, nucl 10, pero 3, mito 2
Family & Domain DBs
Amino Acid Sequences MFEVSQAAGVAGHYQWGLDAGDHQDWDPYAGMQDLNCGDRLGSDAELVEGYEFIRRERTQPILEEKKPRPKPRPLKRGNKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.06
6 0.08
7 0.1
8 0.11
9 0.12
10 0.12
11 0.11
12 0.11
13 0.12
14 0.11
15 0.07
16 0.07
17 0.07
18 0.07
19 0.06
20 0.08
21 0.08
22 0.08
23 0.09
24 0.08
25 0.07
26 0.07
27 0.08
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.04
37 0.04
38 0.06
39 0.07
40 0.07
41 0.13
42 0.14
43 0.16
44 0.21
45 0.26
46 0.26
47 0.31
48 0.4
49 0.43
50 0.48
51 0.55
52 0.59
53 0.65
54 0.72
55 0.77
56 0.76
57 0.78
58 0.84
59 0.86
60 0.89
61 0.89
62 0.91