Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XWP9

Protein Details
Accession A0A0C9XWP9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSPKKKPRRNISGLRNQPKWMHydrophilic
NLS Segment(s)
PositionSequence
5-8KKPR
Subcellular Location(s) nucl 20.5, mito_nucl 13.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSPKKKPRRNISGLRNQPKWMADSSHTDEPMPCIEMADKNTFQQAKEAALAALDGCPVKVIRQFINRSWGWMSAYRMGLTGSVAQCFESRNDALGCGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.81
3 0.72
4 0.66
5 0.57
6 0.49
7 0.4
8 0.33
9 0.27
10 0.31
11 0.35
12 0.36
13 0.35
14 0.33
15 0.3
16 0.28
17 0.27
18 0.21
19 0.15
20 0.1
21 0.11
22 0.13
23 0.16
24 0.19
25 0.18
26 0.17
27 0.22
28 0.22
29 0.21
30 0.21
31 0.18
32 0.14
33 0.14
34 0.14
35 0.1
36 0.09
37 0.08
38 0.06
39 0.05
40 0.04
41 0.04
42 0.03
43 0.04
44 0.04
45 0.05
46 0.08
47 0.11
48 0.14
49 0.22
50 0.26
51 0.27
52 0.35
53 0.34
54 0.34
55 0.33
56 0.31
57 0.26
58 0.26
59 0.27
60 0.25
61 0.26
62 0.24
63 0.22
64 0.21
65 0.19
66 0.16
67 0.18
68 0.14
69 0.14
70 0.14
71 0.14
72 0.15
73 0.16
74 0.16
75 0.16
76 0.16
77 0.18
78 0.19