Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4X033

Protein Details
Accession Q4X033    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-75PQPTEEEEKAKKKKPSKKRPAEGLAGPBasic
252-272LTPPLRYVRKRRFRERLSTRTHydrophilic
NLS Segment(s)
PositionSequence
40-100KITLKIARKPQPTEEEEKAKKKKPSKKRPAEGLAGPSAPEASAQPAGPKRIKLNASKKPGV
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0003743  F:translation initiation factor activity  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
KEGG afm:AFUA_2G14880  -  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
CDD cd08047  TAF7  
Amino Acid Sequences MSDAPRPSLKLTLGKKKAPEGASQPPNQPPPPSSETPQRKITLKIARKPQPTEEEEKAKKKKPSKKRPAEGLAGPSAPEASAQPAGPKRIKLNASKKPGVQSIRIKNKGLVPNRPVGVGYDSEASDTEIDPYIEEQFILRMLPGEDCEYLRQTINERRFDRSEFSFKPLTREGRRAVLRIRDKQYAAALVDLPCIIEGMKSWDRRGWYKSADICQMLLVLGPVSSDAEALNYPLPSDVEILDEKTLQYPHGLTPPLRYVRKRRFRERLSTRTIEQVEKAVEDLIAQDEAAIASRYELLDKTSLNRAEGLVQSGEYYEEDEYYDDEQDAEGELDEGMEEIAADDGGLDPLLEEMEAALRGDNEAQPQGAPSSDTGLANLYQAGTPMATKPSTPAADTSGDESDSDADEEADVPENELDDEQLEQQRQFQQHREEIAELEALIRAETVKWENMQNQILKHKLAKRIQDLKRDLSLKKVSVGEGDDADT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.64
4 0.67
5 0.61
6 0.59
7 0.55
8 0.58
9 0.61
10 0.61
11 0.6
12 0.6
13 0.64
14 0.6
15 0.57
16 0.48
17 0.47
18 0.5
19 0.49
20 0.47
21 0.51
22 0.58
23 0.6
24 0.66
25 0.62
26 0.58
27 0.58
28 0.62
29 0.62
30 0.62
31 0.64
32 0.67
33 0.72
34 0.76
35 0.76
36 0.75
37 0.73
38 0.69
39 0.69
40 0.65
41 0.67
42 0.67
43 0.72
44 0.73
45 0.71
46 0.74
47 0.76
48 0.79
49 0.8
50 0.84
51 0.85
52 0.88
53 0.9
54 0.92
55 0.89
56 0.86
57 0.8
58 0.74
59 0.66
60 0.55
61 0.45
62 0.35
63 0.28
64 0.2
65 0.15
66 0.1
67 0.1
68 0.12
69 0.12
70 0.18
71 0.21
72 0.28
73 0.31
74 0.33
75 0.34
76 0.4
77 0.45
78 0.49
79 0.56
80 0.59
81 0.65
82 0.67
83 0.66
84 0.64
85 0.65
86 0.59
87 0.56
88 0.57
89 0.58
90 0.64
91 0.66
92 0.62
93 0.58
94 0.62
95 0.63
96 0.6
97 0.58
98 0.51
99 0.53
100 0.52
101 0.49
102 0.41
103 0.34
104 0.3
105 0.22
106 0.19
107 0.14
108 0.14
109 0.14
110 0.14
111 0.13
112 0.11
113 0.1
114 0.1
115 0.09
116 0.09
117 0.09
118 0.1
119 0.1
120 0.09
121 0.09
122 0.08
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.07
129 0.07
130 0.08
131 0.1
132 0.11
133 0.12
134 0.13
135 0.14
136 0.15
137 0.15
138 0.15
139 0.18
140 0.25
141 0.32
142 0.39
143 0.39
144 0.44
145 0.45
146 0.47
147 0.46
148 0.43
149 0.44
150 0.37
151 0.4
152 0.41
153 0.38
154 0.41
155 0.43
156 0.45
157 0.41
158 0.45
159 0.42
160 0.44
161 0.46
162 0.44
163 0.43
164 0.44
165 0.48
166 0.51
167 0.53
168 0.49
169 0.48
170 0.46
171 0.43
172 0.37
173 0.29
174 0.22
175 0.18
176 0.14
177 0.14
178 0.12
179 0.1
180 0.07
181 0.07
182 0.06
183 0.04
184 0.04
185 0.11
186 0.16
187 0.18
188 0.19
189 0.21
190 0.24
191 0.27
192 0.31
193 0.28
194 0.25
195 0.3
196 0.33
197 0.35
198 0.35
199 0.32
200 0.28
201 0.24
202 0.21
203 0.15
204 0.11
205 0.08
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.04
216 0.05
217 0.06
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.06
225 0.07
226 0.07
227 0.08
228 0.08
229 0.08
230 0.08
231 0.09
232 0.09
233 0.07
234 0.07
235 0.08
236 0.08
237 0.12
238 0.13
239 0.12
240 0.14
241 0.2
242 0.26
243 0.28
244 0.32
245 0.38
246 0.47
247 0.58
248 0.63
249 0.67
250 0.72
251 0.74
252 0.81
253 0.81
254 0.78
255 0.76
256 0.71
257 0.62
258 0.58
259 0.54
260 0.44
261 0.35
262 0.29
263 0.22
264 0.19
265 0.18
266 0.11
267 0.09
268 0.08
269 0.08
270 0.06
271 0.05
272 0.05
273 0.04
274 0.04
275 0.04
276 0.05
277 0.05
278 0.04
279 0.04
280 0.05
281 0.05
282 0.06
283 0.06
284 0.07
285 0.09
286 0.09
287 0.11
288 0.17
289 0.18
290 0.18
291 0.18
292 0.17
293 0.18
294 0.18
295 0.18
296 0.12
297 0.11
298 0.1
299 0.1
300 0.1
301 0.07
302 0.08
303 0.06
304 0.06
305 0.07
306 0.07
307 0.08
308 0.09
309 0.09
310 0.08
311 0.08
312 0.07
313 0.07
314 0.07
315 0.06
316 0.05
317 0.05
318 0.05
319 0.04
320 0.04
321 0.04
322 0.03
323 0.03
324 0.03
325 0.02
326 0.03
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.03
333 0.03
334 0.03
335 0.03
336 0.03
337 0.03
338 0.03
339 0.03
340 0.04
341 0.04
342 0.04
343 0.05
344 0.05
345 0.05
346 0.07
347 0.08
348 0.09
349 0.1
350 0.1
351 0.1
352 0.11
353 0.11
354 0.1
355 0.09
356 0.08
357 0.11
358 0.12
359 0.12
360 0.12
361 0.13
362 0.13
363 0.12
364 0.12
365 0.09
366 0.07
367 0.08
368 0.08
369 0.07
370 0.07
371 0.08
372 0.11
373 0.11
374 0.11
375 0.13
376 0.19
377 0.2
378 0.2
379 0.2
380 0.2
381 0.23
382 0.23
383 0.24
384 0.19
385 0.18
386 0.17
387 0.16
388 0.14
389 0.12
390 0.12
391 0.09
392 0.08
393 0.08
394 0.08
395 0.09
396 0.11
397 0.1
398 0.1
399 0.1
400 0.1
401 0.11
402 0.1
403 0.1
404 0.07
405 0.08
406 0.11
407 0.15
408 0.17
409 0.17
410 0.21
411 0.28
412 0.33
413 0.37
414 0.41
415 0.45
416 0.49
417 0.52
418 0.51
419 0.46
420 0.41
421 0.38
422 0.31
423 0.22
424 0.17
425 0.15
426 0.11
427 0.1
428 0.09
429 0.07
430 0.07
431 0.11
432 0.14
433 0.16
434 0.18
435 0.23
436 0.26
437 0.32
438 0.38
439 0.38
440 0.39
441 0.44
442 0.45
443 0.44
444 0.49
445 0.49
446 0.53
447 0.56
448 0.61
449 0.63
450 0.71
451 0.75
452 0.77
453 0.77
454 0.73
455 0.74
456 0.71
457 0.62
458 0.61
459 0.6
460 0.52
461 0.51
462 0.48
463 0.4
464 0.38
465 0.4
466 0.33