Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X2L3

Protein Details
Accession A0A0C9X2L3    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-37ASLPRRARSRMRYRSERFRPPREBasic
NLS Segment(s)
PositionSequence
20-31RARSRMRYRSER
Subcellular Location(s) mito 15, mito_nucl 11.499, cyto_mito 10.499, cyto_nucl 6.666, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MGTWGGNSSFPLTNASLPRRARSRMRYRSERFRPPREGFLRRFISSFVDLEVMDRVWGVRRIKDSSGQGSGEWGEFGFLGWGRWKHDWRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.34
4 0.34
5 0.39
6 0.41
7 0.45
8 0.5
9 0.54
10 0.61
11 0.64
12 0.71
13 0.76
14 0.77
15 0.83
16 0.83
17 0.83
18 0.81
19 0.78
20 0.78
21 0.71
22 0.74
23 0.7
24 0.69
25 0.61
26 0.61
27 0.58
28 0.49
29 0.46
30 0.37
31 0.33
32 0.27
33 0.23
34 0.15
35 0.11
36 0.11
37 0.11
38 0.11
39 0.08
40 0.06
41 0.06
42 0.05
43 0.07
44 0.13
45 0.14
46 0.17
47 0.2
48 0.24
49 0.26
50 0.32
51 0.34
52 0.33
53 0.35
54 0.32
55 0.28
56 0.27
57 0.26
58 0.2
59 0.16
60 0.11
61 0.08
62 0.07
63 0.07
64 0.08
65 0.07
66 0.08
67 0.14
68 0.16
69 0.21
70 0.28