Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WJD6

Protein Details
Accession A0A0C9WJD6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-69VDKRPPRKARTTPKKIEPPPBasic
NLS Segment(s)
PositionSequence
48-66RVVDKRPPRKARTTPKKIE
Subcellular Location(s) nucl 14, cyto 7, pero 4
Family & Domain DBs
Amino Acid Sequences MSGKSQHGAGGEYAPDWRPYIQTPPPPEEAPPPLAIPEIPEAKPGGWRVVDKRPPRKARTTPKKIEPPPPAAPVFEVPPPRQNTPAWAQWRPNPLLAPTPPVVPSVAPTGPPPRSGLFGASTPPPGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.15
5 0.15
6 0.17
7 0.24
8 0.29
9 0.35
10 0.4
11 0.43
12 0.47
13 0.45
14 0.44
15 0.42
16 0.39
17 0.34
18 0.3
19 0.25
20 0.21
21 0.21
22 0.19
23 0.16
24 0.16
25 0.16
26 0.15
27 0.16
28 0.16
29 0.16
30 0.19
31 0.18
32 0.17
33 0.15
34 0.17
35 0.2
36 0.29
37 0.37
38 0.42
39 0.51
40 0.58
41 0.65
42 0.68
43 0.73
44 0.73
45 0.76
46 0.79
47 0.79
48 0.76
49 0.77
50 0.81
51 0.76
52 0.76
53 0.69
54 0.65
55 0.59
56 0.56
57 0.48
58 0.39
59 0.35
60 0.27
61 0.24
62 0.2
63 0.2
64 0.17
65 0.24
66 0.27
67 0.28
68 0.29
69 0.28
70 0.29
71 0.3
72 0.37
73 0.36
74 0.37
75 0.38
76 0.41
77 0.47
78 0.44
79 0.42
80 0.36
81 0.31
82 0.34
83 0.31
84 0.31
85 0.25
86 0.25
87 0.23
88 0.22
89 0.21
90 0.15
91 0.16
92 0.16
93 0.16
94 0.15
95 0.18
96 0.24
97 0.25
98 0.26
99 0.28
100 0.24
101 0.27
102 0.27
103 0.27
104 0.22
105 0.22
106 0.23
107 0.23
108 0.23