Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YCS3

Protein Details
Accession A0A0C9YCS3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-62VTRGAGFRKEKNKKKRGSYRGGEITBasic
NLS Segment(s)
PositionSequence
44-54FRKEKNKKKRG
Subcellular Location(s) nucl 13, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MRVRPETVAMNTFVDNRYEAKAGASNDYGQRAHSDLIVTRGAGFRKEKNKKKRGSYRGGEITMDSHSFKFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.16
5 0.15
6 0.14
7 0.14
8 0.18
9 0.17
10 0.19
11 0.18
12 0.18
13 0.18
14 0.21
15 0.19
16 0.15
17 0.15
18 0.14
19 0.13
20 0.11
21 0.11
22 0.09
23 0.11
24 0.11
25 0.1
26 0.09
27 0.11
28 0.11
29 0.14
30 0.16
31 0.2
32 0.31
33 0.41
34 0.5
35 0.59
36 0.68
37 0.74
38 0.82
39 0.87
40 0.86
41 0.86
42 0.82
43 0.81
44 0.8
45 0.73
46 0.63
47 0.53
48 0.44
49 0.37
50 0.33
51 0.24