Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X016

Protein Details
Accession A0A0C9X016    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
43-68GPHLTSPERKYPKRRNCQEHKSDAPMHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7, mito 6.5, plas 6, cyto_mito 5, nucl 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences FSALFPVPSLAPCPFFLFLLVLPLVTLIAGRCTPYLSSAPTSGPHLTSPERKYPKRRNCQEHKSDAPMRLCFPSWCWAPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.16
5 0.14
6 0.15
7 0.14
8 0.1
9 0.09
10 0.08
11 0.07
12 0.06
13 0.06
14 0.03
15 0.05
16 0.05
17 0.06
18 0.06
19 0.07
20 0.07
21 0.09
22 0.11
23 0.11
24 0.12
25 0.13
26 0.13
27 0.13
28 0.16
29 0.14
30 0.14
31 0.12
32 0.14
33 0.16
34 0.23
35 0.26
36 0.32
37 0.4
38 0.45
39 0.56
40 0.64
41 0.71
42 0.76
43 0.82
44 0.83
45 0.85
46 0.9
47 0.89
48 0.87
49 0.82
50 0.79
51 0.75
52 0.71
53 0.66
54 0.58
55 0.52
56 0.46
57 0.42
58 0.35
59 0.32
60 0.33