Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XG11

Protein Details
Accession A0A0C9XG11    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
167-186DTVQKRVRDVQPPRGRRPTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 4, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036748  MTH938-like_sf  
IPR007523  NDUFAF3/AAMDC  
Pfam View protein in Pfam  
PF04430  DUF498  
Amino Acid Sequences MSLRTHTFRQLGRGFPTFHCTQILGQRPLLPTPTRLFLRTFQTTSRTSDRSFTNLLADADNPPPVQVSSISDKEGIRLVDGLVLSSASIFLEGQVYLWDVPPLKTGEGGKIEKDQWKGWTEGHFELFDIVVPKPEILLLGTGKRIVQPPPFMRTYLNNRGIQLDVMDTVQKRVRDVQPPRGRRPTCRSGLITH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.46
4 0.39
5 0.35
6 0.32
7 0.27
8 0.26
9 0.31
10 0.39
11 0.35
12 0.35
13 0.38
14 0.38
15 0.38
16 0.39
17 0.32
18 0.27
19 0.27
20 0.32
21 0.3
22 0.3
23 0.31
24 0.31
25 0.37
26 0.38
27 0.37
28 0.33
29 0.36
30 0.36
31 0.39
32 0.4
33 0.36
34 0.32
35 0.34
36 0.34
37 0.33
38 0.33
39 0.28
40 0.25
41 0.24
42 0.23
43 0.2
44 0.18
45 0.16
46 0.16
47 0.16
48 0.14
49 0.11
50 0.11
51 0.1
52 0.1
53 0.08
54 0.11
55 0.15
56 0.16
57 0.17
58 0.19
59 0.19
60 0.19
61 0.2
62 0.17
63 0.12
64 0.11
65 0.1
66 0.09
67 0.09
68 0.08
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.03
75 0.03
76 0.03
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.08
89 0.09
90 0.08
91 0.1
92 0.1
93 0.13
94 0.17
95 0.18
96 0.17
97 0.19
98 0.21
99 0.24
100 0.26
101 0.25
102 0.23
103 0.25
104 0.25
105 0.24
106 0.26
107 0.26
108 0.25
109 0.25
110 0.21
111 0.19
112 0.18
113 0.16
114 0.13
115 0.1
116 0.09
117 0.09
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.06
124 0.09
125 0.08
126 0.1
127 0.11
128 0.11
129 0.12
130 0.13
131 0.15
132 0.17
133 0.2
134 0.28
135 0.31
136 0.36
137 0.37
138 0.36
139 0.36
140 0.4
141 0.44
142 0.46
143 0.5
144 0.46
145 0.46
146 0.47
147 0.45
148 0.38
149 0.3
150 0.21
151 0.14
152 0.12
153 0.15
154 0.13
155 0.16
156 0.2
157 0.2
158 0.21
159 0.28
160 0.34
161 0.41
162 0.48
163 0.56
164 0.62
165 0.7
166 0.77
167 0.8
168 0.78
169 0.77
170 0.78
171 0.77
172 0.73
173 0.73