Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WM13

Protein Details
Accession A0A0C9WM13    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21LSPTTKKNHRSRAQLKHFDKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences LSPTTKKNHRSRAQLKHFDKIPVPRNNDAQSSTTTAFHSSIISLAPKEQGGEWLVICCLETAGQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.82
3 0.78
4 0.73
5 0.66
6 0.61
7 0.58
8 0.56
9 0.53
10 0.55
11 0.51
12 0.53
13 0.51
14 0.48
15 0.42
16 0.34
17 0.28
18 0.26
19 0.24
20 0.2
21 0.18
22 0.17
23 0.15
24 0.14
25 0.12
26 0.09
27 0.08
28 0.08
29 0.09
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.11
37 0.11
38 0.12
39 0.12
40 0.12
41 0.12
42 0.11
43 0.11
44 0.08
45 0.08