Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XHI6

Protein Details
Accession A0A0C9XHI6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-66RPKPPQLPREKGKKERKRNYPEGVWBasic
NLS Segment(s)
PositionSequence
42-59RPKPPQLPREKGKKERKR
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 7.333, cyto 5, cyto_pero 3.333
Family & Domain DBs
Amino Acid Sequences MTVQPPHGDMDANAQRFPKSVTSSLLTVTWMPTLPGSCPGARPKPPQLPREKGKKERKRNYPEGVWLSSLLTVTWVPALNGFRRNVTSSLLTVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.27
4 0.3
5 0.25
6 0.23
7 0.23
8 0.25
9 0.27
10 0.27
11 0.27
12 0.25
13 0.21
14 0.16
15 0.15
16 0.12
17 0.09
18 0.09
19 0.08
20 0.09
21 0.08
22 0.11
23 0.13
24 0.12
25 0.15
26 0.2
27 0.26
28 0.3
29 0.34
30 0.38
31 0.46
32 0.52
33 0.57
34 0.6
35 0.61
36 0.63
37 0.69
38 0.7
39 0.71
40 0.75
41 0.79
42 0.81
43 0.84
44 0.88
45 0.87
46 0.87
47 0.83
48 0.76
49 0.74
50 0.68
51 0.59
52 0.5
53 0.4
54 0.32
55 0.26
56 0.22
57 0.13
58 0.1
59 0.08
60 0.07
61 0.09
62 0.08
63 0.08
64 0.12
65 0.15
66 0.17
67 0.23
68 0.24
69 0.25
70 0.28
71 0.31
72 0.29
73 0.3
74 0.29