Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9X6R4

Protein Details
Accession A0A0C9X6R4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-112EDPVVTTQKKKKKKKPKKSVKAKEAAAQHydrophilic
NLS Segment(s)
PositionSequence
93-107KKKKKKKPKKSVKAK
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSVRVLNAELTAKQKGFFLSGPHRDCFLRRERHRILLLKAMNTATTPVDDIPSFPDTDESTTPISEPWTPLIRSGETSPDSEVIEDPVVTTQKKKKKKKPKKSVKAKEAAAQSNATTAKSRVALPSLPFLFSPRGSPIISLKGGLMSPRRNRHLRAWCWLGVSYWEIALPELLGTPKGIAALTEFLKESGAFTFTGGKYLPKDAPTFEDEPEPPDIDSEDEASDSDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.22
5 0.26
6 0.31
7 0.4
8 0.44
9 0.43
10 0.44
11 0.43
12 0.43
13 0.43
14 0.43
15 0.44
16 0.46
17 0.55
18 0.58
19 0.65
20 0.7
21 0.69
22 0.63
23 0.61
24 0.59
25 0.5
26 0.47
27 0.39
28 0.32
29 0.26
30 0.24
31 0.15
32 0.12
33 0.12
34 0.1
35 0.11
36 0.11
37 0.11
38 0.13
39 0.14
40 0.14
41 0.13
42 0.14
43 0.13
44 0.17
45 0.17
46 0.15
47 0.15
48 0.15
49 0.15
50 0.13
51 0.15
52 0.12
53 0.13
54 0.14
55 0.17
56 0.17
57 0.2
58 0.22
59 0.21
60 0.22
61 0.22
62 0.23
63 0.2
64 0.21
65 0.19
66 0.18
67 0.17
68 0.16
69 0.14
70 0.11
71 0.09
72 0.08
73 0.08
74 0.08
75 0.1
76 0.09
77 0.14
78 0.2
79 0.29
80 0.39
81 0.5
82 0.59
83 0.69
84 0.8
85 0.87
86 0.91
87 0.94
88 0.94
89 0.96
90 0.96
91 0.94
92 0.9
93 0.8
94 0.74
95 0.68
96 0.59
97 0.49
98 0.38
99 0.28
100 0.24
101 0.22
102 0.17
103 0.13
104 0.11
105 0.11
106 0.12
107 0.13
108 0.1
109 0.12
110 0.13
111 0.13
112 0.18
113 0.17
114 0.16
115 0.16
116 0.17
117 0.17
118 0.16
119 0.16
120 0.13
121 0.15
122 0.15
123 0.16
124 0.16
125 0.18
126 0.18
127 0.16
128 0.14
129 0.13
130 0.13
131 0.15
132 0.17
133 0.2
134 0.28
135 0.34
136 0.41
137 0.44
138 0.47
139 0.55
140 0.6
141 0.57
142 0.57
143 0.56
144 0.5
145 0.49
146 0.45
147 0.36
148 0.27
149 0.24
150 0.17
151 0.12
152 0.1
153 0.09
154 0.08
155 0.08
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.05
167 0.07
168 0.1
169 0.11
170 0.12
171 0.12
172 0.12
173 0.12
174 0.12
175 0.12
176 0.09
177 0.1
178 0.09
179 0.09
180 0.16
181 0.15
182 0.18
183 0.17
184 0.19
185 0.2
186 0.24
187 0.27
188 0.23
189 0.25
190 0.25
191 0.29
192 0.32
193 0.33
194 0.29
195 0.32
196 0.29
197 0.31
198 0.32
199 0.29
200 0.23
201 0.21
202 0.21
203 0.17
204 0.18
205 0.17
206 0.14
207 0.13