Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WLP3

Protein Details
Accession A0A0C9WLP3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
5-25VPEKRHRSRLIQPSQNKPCPMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.5, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences VCCVVPEKRHRSRLIQPSQNKPCPMTASNTSGSWTSIVYVRLLPLLDGTCPTVHRSTANPSIANPKRFTSPRPLPVNQRATVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.74
4 0.77
5 0.82
6 0.81
7 0.73
8 0.64
9 0.56
10 0.52
11 0.46
12 0.41
13 0.35
14 0.33
15 0.33
16 0.31
17 0.29
18 0.24
19 0.23
20 0.17
21 0.13
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.08
28 0.09
29 0.08
30 0.08
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.08
38 0.11
39 0.11
40 0.11
41 0.13
42 0.15
43 0.2
44 0.27
45 0.3
46 0.28
47 0.28
48 0.38
49 0.43
50 0.45
51 0.41
52 0.36
53 0.4
54 0.42
55 0.45
56 0.45
57 0.48
58 0.53
59 0.59
60 0.62
61 0.64
62 0.71
63 0.75