Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XDZ4

Protein Details
Accession A0A0C9XDZ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTRIRATRKQRKFLSRVQASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MTRIRATRKQRKFLSRVQASGLVVRLSGLMHDEYKVVLWRSGNRCLFHPVKGWQEVLDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.68
4 0.61
5 0.56
6 0.46
7 0.41
8 0.34
9 0.23
10 0.16
11 0.15
12 0.11
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.1
23 0.09
24 0.1
25 0.11
26 0.19
27 0.23
28 0.32
29 0.36
30 0.35
31 0.36
32 0.42
33 0.43
34 0.38
35 0.4
36 0.37
37 0.39
38 0.41
39 0.39
40 0.32