Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XVE0

Protein Details
Accession A0A0C9XVE0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
84-103DYLAPFKKLFSQPRRNPTRSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 2, E.R. 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSNENEQARHHRGGHPKLTLYRILVIALTAGFGLWKAALSYRGESTAPTTLDWVYGVVVFLLLYWLGIYEKYALHNMPWLFEQDYLAPFKKLFSQPRRNPTRSSSIRLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.57
3 0.56
4 0.55
5 0.55
6 0.5
7 0.42
8 0.37
9 0.3
10 0.25
11 0.2
12 0.16
13 0.13
14 0.1
15 0.08
16 0.05
17 0.04
18 0.03
19 0.03
20 0.04
21 0.03
22 0.03
23 0.03
24 0.05
25 0.07
26 0.09
27 0.11
28 0.11
29 0.13
30 0.13
31 0.13
32 0.14
33 0.15
34 0.14
35 0.13
36 0.13
37 0.11
38 0.12
39 0.11
40 0.09
41 0.06
42 0.05
43 0.05
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.06
58 0.07
59 0.09
60 0.09
61 0.09
62 0.15
63 0.14
64 0.14
65 0.14
66 0.16
67 0.15
68 0.16
69 0.17
70 0.13
71 0.15
72 0.18
73 0.19
74 0.17
75 0.16
76 0.17
77 0.23
78 0.29
79 0.38
80 0.44
81 0.54
82 0.63
83 0.73
84 0.82
85 0.79
86 0.76
87 0.72
88 0.73
89 0.68