Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XZ61

Protein Details
Accession A0A0C9XZ61    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAIKIVKKRTTKFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-49KKRTTKFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQTPMP
Subcellular Location(s) nucl 15, mito_nucl 13, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIVKKRTTKFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKKTRHLLPNGLKKFLVNNVREVDLLLMHNKTFAAEIAHGVSSRNRTTILER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.91
4 0.9
5 0.89
6 0.87
7 0.84
8 0.77
9 0.67
10 0.63
11 0.61
12 0.61
13 0.6
14 0.6
15 0.58
16 0.56
17 0.57
18 0.6
19 0.62
20 0.63
21 0.63
22 0.65
23 0.7
24 0.78
25 0.82
26 0.75
27 0.73
28 0.7
29 0.67
30 0.67
31 0.64
32 0.65
33 0.66
34 0.69
35 0.62
36 0.56
37 0.5
38 0.43
39 0.44
40 0.38
41 0.38
42 0.42
43 0.43
44 0.44
45 0.47
46 0.47
47 0.46
48 0.46
49 0.48
50 0.47
51 0.56
52 0.57
53 0.55
54 0.51
55 0.43
56 0.4
57 0.37
58 0.36
59 0.27
60 0.29
61 0.29
62 0.3
63 0.3
64 0.28
65 0.22
66 0.15
67 0.15
68 0.13
69 0.12
70 0.11
71 0.11
72 0.11
73 0.1
74 0.1
75 0.09
76 0.1
77 0.09
78 0.11
79 0.13
80 0.14
81 0.13
82 0.14
83 0.18
84 0.2
85 0.21
86 0.21
87 0.21