Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XQK5

Protein Details
Accession A0A0C9XQK5    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-72PTPTKSKPTSNQRLRSRTRRRTPSQLIRHRPRAGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MGKGRWPFSTYMIHSPVVSFNIQAYEWPVDWAAKETLPTPTKSKPTSNQRLRSRTRRRTPSQLIRHRPRAGCDTVPYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.3
4 0.24
5 0.2
6 0.14
7 0.11
8 0.12
9 0.12
10 0.11
11 0.12
12 0.12
13 0.12
14 0.12
15 0.12
16 0.11
17 0.11
18 0.13
19 0.11
20 0.09
21 0.1
22 0.1
23 0.16
24 0.17
25 0.19
26 0.2
27 0.23
28 0.28
29 0.31
30 0.35
31 0.37
32 0.46
33 0.55
34 0.61
35 0.67
36 0.71
37 0.77
38 0.81
39 0.83
40 0.84
41 0.84
42 0.85
43 0.85
44 0.83
45 0.85
46 0.87
47 0.87
48 0.86
49 0.86
50 0.87
51 0.87
52 0.89
53 0.86
54 0.79
55 0.74
56 0.69
57 0.65
58 0.58