Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XH83

Protein Details
Accession A0A0C9XH83    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-105EQKKLQQRVKDDKKREKVRKAMERKRLEWEKESKKREKLRSKYQKELRKGEEBasic
110-130EQDKTKQWLEKQKKEKAEPSSHydrophilic
NLS Segment(s)
PositionSequence
53-124GEQKKLQQRVKDDKKREKVRKAMERKRLEWEKESKKREKLRSKYQKELRKGEEKWKQEQDKTKQWLEKQKKE
Subcellular Location(s) mito 6plas 6, nucl 5, cyto 3, golg 3, extr 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MIAFFIFLVIVLGFLSMFASTGNEKAVMKLSEEEKAHNMLKETVERERVAWKGEQKKLQQRVKDDKKREKVRKAMERKRLEWEKESKKREKLRSKYQKELRKGEEKWKQEQDKTKQWLEKQKKEKAEPSSDSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.04
4 0.04
5 0.04
6 0.06
7 0.07
8 0.08
9 0.09
10 0.1
11 0.1
12 0.11
13 0.16
14 0.15
15 0.15
16 0.18
17 0.19
18 0.23
19 0.24
20 0.25
21 0.22
22 0.26
23 0.26
24 0.23
25 0.24
26 0.2
27 0.21
28 0.23
29 0.24
30 0.23
31 0.25
32 0.24
33 0.23
34 0.25
35 0.24
36 0.22
37 0.23
38 0.27
39 0.33
40 0.38
41 0.43
42 0.46
43 0.55
44 0.62
45 0.64
46 0.61
47 0.6
48 0.66
49 0.7
50 0.73
51 0.73
52 0.73
53 0.78
54 0.84
55 0.85
56 0.82
57 0.79
58 0.8
59 0.81
60 0.82
61 0.81
62 0.8
63 0.78
64 0.72
65 0.73
66 0.71
67 0.64
68 0.59
69 0.6
70 0.61
71 0.64
72 0.69
73 0.67
74 0.69
75 0.75
76 0.79
77 0.8
78 0.78
79 0.8
80 0.84
81 0.84
82 0.86
83 0.86
84 0.84
85 0.82
86 0.81
87 0.77
88 0.75
89 0.71
90 0.71
91 0.71
92 0.67
93 0.67
94 0.68
95 0.68
96 0.66
97 0.73
98 0.71
99 0.72
100 0.74
101 0.73
102 0.69
103 0.7
104 0.73
105 0.74
106 0.76
107 0.75
108 0.78
109 0.8
110 0.81
111 0.81
112 0.79
113 0.78
114 0.73