Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WSL1

Protein Details
Accession A0A0C9WSL1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-46KYEGKGKKKAPSSPTKPKPKKHDDRDKTLVKRKHBasic
NLS Segment(s)
PositionSequence
12-48KKYEGKGKKKAPSSPTKPKPKKHDDRDKTLVKRKHKK
Subcellular Location(s) nucl 13, mito_nucl 11, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MPPVIHGAPEVKKYEGKGKKKAPSSPTKPKPKKHDDRDKTLVKRKHKKIMNLSDSDEGAVSVLVLGLGYHSLCLPYCLYHIPGGLYTPPHVLISADQNYAYVLPQPFWLEINSAMAHSASLSAEPLKAVLSAEQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.49
4 0.54
5 0.61
6 0.67
7 0.72
8 0.77
9 0.75
10 0.77
11 0.78
12 0.79
13 0.8
14 0.83
15 0.85
16 0.86
17 0.87
18 0.87
19 0.89
20 0.88
21 0.9
22 0.86
23 0.86
24 0.86
25 0.85
26 0.82
27 0.81
28 0.77
29 0.76
30 0.79
31 0.78
32 0.78
33 0.75
34 0.75
35 0.76
36 0.8
37 0.76
38 0.68
39 0.64
40 0.56
41 0.5
42 0.41
43 0.3
44 0.19
45 0.12
46 0.08
47 0.05
48 0.03
49 0.03
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.05
61 0.05
62 0.05
63 0.07
64 0.08
65 0.09
66 0.1
67 0.1
68 0.09
69 0.09
70 0.1
71 0.1
72 0.09
73 0.09
74 0.09
75 0.1
76 0.09
77 0.09
78 0.09
79 0.09
80 0.15
81 0.16
82 0.16
83 0.15
84 0.15
85 0.15
86 0.15
87 0.14
88 0.12
89 0.1
90 0.1
91 0.12
92 0.14
93 0.14
94 0.15
95 0.15
96 0.12
97 0.12
98 0.15
99 0.14
100 0.12
101 0.12
102 0.11
103 0.1
104 0.09
105 0.09
106 0.06
107 0.06
108 0.08
109 0.08
110 0.08
111 0.09
112 0.09
113 0.08
114 0.08
115 0.09