Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YHT9

Protein Details
Accession A0A0C9YHT9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-46HDTFPTPTAAPPRRRRRRSRAARSPSLTRSTHydrophilic
NLS Segment(s)
PositionSequence
26-39PPRRRRRRSRAARS
Subcellular Location(s) plas 23, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
Amino Acid Sequences MTRTPPQPDTATGIAHDTFPTPTAAPPRRRRRRSRAARSPSLTRSTTSSSKRSPSPIVSFSPSGENAKGVKNITRKVIKTLEGLGHLDVVDMVTYEEGDEEERRHDRGVEKIEKRDLRSAGAKPETNGHSHSHLTTVNGNGNGAVDGGSVDKTKKLDLEIPRKALHASIGFFTLYLYVSESDARKITLALWTALAIIVPADMLRFRSQRFERTYERFLGFLMRESEKNSTNGVVWYILGVNFVLSLYPQDVATVAILILSWADTAASTFGRLYGSSTSRLPARLPILRLPLAPRKSVAGFTAASITGALIAVGFWSLVAPFRNGGRDVTWALEGGVRAAGQHLGGGGWAGLALIGLVAGVVSGVAEALDLGSLDDNLTLPIISGGCILGFLKLLGMVTSWFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.21
4 0.16
5 0.15
6 0.15
7 0.16
8 0.14
9 0.17
10 0.27
11 0.35
12 0.44
13 0.54
14 0.64
15 0.73
16 0.83
17 0.9
18 0.9
19 0.93
20 0.94
21 0.94
22 0.94
23 0.93
24 0.93
25 0.88
26 0.86
27 0.81
28 0.76
29 0.66
30 0.56
31 0.51
32 0.47
33 0.49
34 0.48
35 0.48
36 0.48
37 0.52
38 0.55
39 0.56
40 0.56
41 0.55
42 0.55
43 0.52
44 0.51
45 0.5
46 0.47
47 0.42
48 0.4
49 0.35
50 0.32
51 0.27
52 0.26
53 0.23
54 0.25
55 0.27
56 0.25
57 0.29
58 0.33
59 0.36
60 0.41
61 0.47
62 0.45
63 0.48
64 0.51
65 0.48
66 0.43
67 0.44
68 0.39
69 0.34
70 0.34
71 0.27
72 0.22
73 0.19
74 0.16
75 0.12
76 0.09
77 0.06
78 0.05
79 0.05
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.06
86 0.07
87 0.08
88 0.13
89 0.15
90 0.16
91 0.17
92 0.2
93 0.21
94 0.27
95 0.35
96 0.4
97 0.43
98 0.47
99 0.55
100 0.56
101 0.57
102 0.57
103 0.49
104 0.43
105 0.44
106 0.42
107 0.41
108 0.43
109 0.4
110 0.34
111 0.39
112 0.37
113 0.33
114 0.32
115 0.26
116 0.24
117 0.25
118 0.24
119 0.21
120 0.19
121 0.19
122 0.19
123 0.19
124 0.18
125 0.17
126 0.17
127 0.14
128 0.14
129 0.12
130 0.1
131 0.07
132 0.04
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.08
139 0.09
140 0.1
141 0.1
142 0.12
143 0.18
144 0.26
145 0.36
146 0.39
147 0.42
148 0.42
149 0.42
150 0.4
151 0.33
152 0.27
153 0.19
154 0.15
155 0.12
156 0.13
157 0.12
158 0.11
159 0.11
160 0.09
161 0.07
162 0.06
163 0.06
164 0.06
165 0.07
166 0.09
167 0.09
168 0.1
169 0.1
170 0.1
171 0.09
172 0.09
173 0.09
174 0.1
175 0.11
176 0.1
177 0.09
178 0.09
179 0.09
180 0.09
181 0.08
182 0.05
183 0.03
184 0.03
185 0.02
186 0.02
187 0.02
188 0.03
189 0.04
190 0.07
191 0.09
192 0.1
193 0.18
194 0.2
195 0.27
196 0.32
197 0.36
198 0.4
199 0.44
200 0.47
201 0.43
202 0.42
203 0.35
204 0.3
205 0.28
206 0.22
207 0.19
208 0.18
209 0.16
210 0.15
211 0.17
212 0.2
213 0.19
214 0.2
215 0.18
216 0.15
217 0.15
218 0.14
219 0.13
220 0.11
221 0.08
222 0.08
223 0.07
224 0.06
225 0.06
226 0.05
227 0.04
228 0.04
229 0.04
230 0.04
231 0.03
232 0.04
233 0.04
234 0.05
235 0.05
236 0.05
237 0.05
238 0.06
239 0.06
240 0.05
241 0.04
242 0.04
243 0.04
244 0.03
245 0.03
246 0.03
247 0.03
248 0.02
249 0.02
250 0.02
251 0.03
252 0.04
253 0.04
254 0.05
255 0.05
256 0.06
257 0.07
258 0.07
259 0.08
260 0.11
261 0.13
262 0.15
263 0.16
264 0.17
265 0.18
266 0.19
267 0.18
268 0.19
269 0.22
270 0.24
271 0.27
272 0.29
273 0.33
274 0.33
275 0.33
276 0.34
277 0.38
278 0.36
279 0.34
280 0.31
281 0.29
282 0.29
283 0.29
284 0.25
285 0.19
286 0.17
287 0.16
288 0.18
289 0.14
290 0.13
291 0.11
292 0.1
293 0.07
294 0.07
295 0.06
296 0.03
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.06
305 0.07
306 0.08
307 0.1
308 0.12
309 0.15
310 0.16
311 0.17
312 0.17
313 0.19
314 0.19
315 0.2
316 0.19
317 0.16
318 0.15
319 0.15
320 0.14
321 0.11
322 0.1
323 0.08
324 0.08
325 0.09
326 0.09
327 0.07
328 0.07
329 0.06
330 0.05
331 0.05
332 0.06
333 0.04
334 0.04
335 0.03
336 0.03
337 0.03
338 0.03
339 0.03
340 0.02
341 0.02
342 0.02
343 0.02
344 0.02
345 0.02
346 0.02
347 0.02
348 0.02
349 0.02
350 0.02
351 0.02
352 0.02
353 0.02
354 0.03
355 0.03
356 0.03
357 0.04
358 0.04
359 0.05
360 0.05
361 0.06
362 0.06
363 0.06
364 0.07
365 0.06
366 0.06
367 0.07
368 0.07
369 0.07
370 0.08
371 0.07
372 0.07
373 0.08
374 0.08
375 0.07
376 0.07
377 0.07
378 0.07
379 0.07
380 0.07
381 0.07
382 0.07