Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WGG5

Protein Details
Accession A0A0C9WGG5    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
132-164LNENRRPKKYLKNSVRTKQRHKRIGKNLEKQGYHydrophilic
NLS Segment(s)
PositionSequence
136-157RRPKKYLKNSVRTKQRHKRIGK
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MPRKSKAAKSRIENLGSKAQKKPSVTIEDVPDEDDFNCKPASLDLAQSDEGMYEEAFIVDEEDGSLTLVGFLNDFGEEHLPDLAHDLDSDDENDENPRDNYSEIEELSDLEQFSRILSEAQRIAVEAEDERLNENRRPKKYLKNSVRTKQRHKRIGKNLEKQGYLSIRTWFAKAKVAEGEASEVARGQNSESDVEMATVDENLENISAEEGNSVSLILWNAEVTVLLTKYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.63
3 0.61
4 0.59
5 0.55
6 0.55
7 0.55
8 0.54
9 0.54
10 0.52
11 0.53
12 0.53
13 0.51
14 0.48
15 0.46
16 0.44
17 0.4
18 0.33
19 0.26
20 0.22
21 0.2
22 0.15
23 0.14
24 0.13
25 0.12
26 0.12
27 0.11
28 0.16
29 0.14
30 0.17
31 0.16
32 0.19
33 0.2
34 0.19
35 0.18
36 0.13
37 0.12
38 0.1
39 0.08
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.07
67 0.07
68 0.07
69 0.09
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.12
89 0.13
90 0.11
91 0.11
92 0.1
93 0.1
94 0.1
95 0.1
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.06
105 0.08
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.08
112 0.08
113 0.05
114 0.07
115 0.07
116 0.07
117 0.08
118 0.11
119 0.14
120 0.17
121 0.26
122 0.32
123 0.35
124 0.41
125 0.45
126 0.53
127 0.61
128 0.69
129 0.7
130 0.73
131 0.79
132 0.81
133 0.86
134 0.84
135 0.84
136 0.83
137 0.83
138 0.83
139 0.82
140 0.83
141 0.84
142 0.87
143 0.86
144 0.85
145 0.84
146 0.79
147 0.71
148 0.61
149 0.56
150 0.48
151 0.4
152 0.32
153 0.26
154 0.25
155 0.26
156 0.26
157 0.24
158 0.22
159 0.26
160 0.25
161 0.25
162 0.24
163 0.24
164 0.23
165 0.21
166 0.22
167 0.16
168 0.15
169 0.12
170 0.11
171 0.1
172 0.1
173 0.1
174 0.08
175 0.1
176 0.11
177 0.12
178 0.12
179 0.13
180 0.13
181 0.13
182 0.12
183 0.09
184 0.08
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.06
202 0.07
203 0.08
204 0.07
205 0.08
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.1