Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YAQ4

Protein Details
Accession A0A0C9YAQ4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-41DGHSCYRPRRTGERKRKSVRGCIVGBasic
122-141TPLRLQRRRHLNALKRRRIEBasic
NLS Segment(s)
PositionSequence
29-32ERKR
97-143RREVKSAKKADAKPYTKAPKIQRLVTPLRLQRRRHLNALKRRRIEHQ
157-167RVSEKKAKAAA
Subcellular Location(s) mito 13, cyto 5.5, cyto_nucl 4.5, extr 3, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
Amino Acid Sequences MKQGVLLPSRVRLLLADGHSCYRPRRTGERKRKSVRGCIVGPDIAVLSLVIVKQGESEIPGLTDTVLPKRLGPKRATKIRSFFNLGKEDDVRKYVVRREVKSAKKADAKPYTKAPKIQRLVTPLRLQRRRHLNALKRRRIEHQKEQKVEYDALIAKRVSEKKAKAAAIKASHHKATAAATSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.24
5 0.26
6 0.28
7 0.31
8 0.32
9 0.33
10 0.35
11 0.38
12 0.47
13 0.55
14 0.64
15 0.73
16 0.8
17 0.84
18 0.86
19 0.9
20 0.85
21 0.85
22 0.82
23 0.77
24 0.68
25 0.62
26 0.57
27 0.47
28 0.4
29 0.31
30 0.22
31 0.14
32 0.13
33 0.08
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.1
53 0.13
54 0.12
55 0.14
56 0.22
57 0.27
58 0.32
59 0.35
60 0.42
61 0.49
62 0.58
63 0.61
64 0.58
65 0.57
66 0.56
67 0.56
68 0.52
69 0.45
70 0.42
71 0.41
72 0.36
73 0.34
74 0.31
75 0.29
76 0.24
77 0.23
78 0.18
79 0.15
80 0.17
81 0.19
82 0.25
83 0.29
84 0.3
85 0.37
86 0.44
87 0.49
88 0.54
89 0.53
90 0.51
91 0.53
92 0.55
93 0.56
94 0.57
95 0.55
96 0.51
97 0.57
98 0.58
99 0.53
100 0.57
101 0.54
102 0.54
103 0.55
104 0.56
105 0.51
106 0.5
107 0.53
108 0.51
109 0.52
110 0.48
111 0.54
112 0.58
113 0.57
114 0.58
115 0.63
116 0.62
117 0.65
118 0.69
119 0.68
120 0.71
121 0.8
122 0.81
123 0.75
124 0.74
125 0.74
126 0.75
127 0.75
128 0.75
129 0.75
130 0.76
131 0.75
132 0.75
133 0.71
134 0.64
135 0.55
136 0.45
137 0.39
138 0.33
139 0.29
140 0.29
141 0.24
142 0.21
143 0.28
144 0.31
145 0.31
146 0.36
147 0.38
148 0.43
149 0.51
150 0.54
151 0.51
152 0.53
153 0.57
154 0.55
155 0.58
156 0.58
157 0.57
158 0.55
159 0.5
160 0.45
161 0.38
162 0.35