Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XGR7

Protein Details
Accession A0A0C9XGR7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-36KTTPAKSRKRQASNTDKQSVKHSSCRQNNNNNNNKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences KTTPAKSRKRQASNTDKQSVKHSSCRQNNNNNNNKENPDQWANYEEQAMETKGRAGKGGKQGWARAPAQRCVPPIHLPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.76
4 0.67
5 0.65
6 0.62
7 0.55
8 0.54
9 0.54
10 0.56
11 0.62
12 0.71
13 0.72
14 0.75
15 0.8
16 0.81
17 0.82
18 0.77
19 0.72
20 0.65
21 0.61
22 0.52
23 0.44
24 0.37
25 0.31
26 0.27
27 0.24
28 0.23
29 0.2
30 0.18
31 0.17
32 0.13
33 0.1
34 0.11
35 0.11
36 0.09
37 0.08
38 0.11
39 0.13
40 0.13
41 0.15
42 0.15
43 0.21
44 0.3
45 0.34
46 0.37
47 0.38
48 0.42
49 0.44
50 0.49
51 0.44
52 0.41
53 0.42
54 0.41
55 0.44
56 0.46
57 0.43
58 0.43
59 0.46