Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XLE3

Protein Details
Accession A0A0C9XLE3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40QTLRGAFRSRKSPKKKVICKRLPGAYHHydrophilic
NLS Segment(s)
PositionSequence
21-29RSRKSPKKK
Subcellular Location(s) mito 17.5, mito_nucl 13.666, nucl 8.5, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MKKIVWHNSRMSLQTLRGAFRSRKSPKKKVICKRLPGAYHVLRQMPAPPLDRKATAPSFERSCSQQLKRPVLPPLGPDRPDRLYSSLQYDGHTRREITLPPTVPWRETSTPTRITIASKHIFLHSQKEYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.33
4 0.31
5 0.35
6 0.34
7 0.35
8 0.44
9 0.47
10 0.55
11 0.63
12 0.7
13 0.75
14 0.82
15 0.88
16 0.88
17 0.9
18 0.89
19 0.87
20 0.84
21 0.82
22 0.73
23 0.65
24 0.63
25 0.56
26 0.5
27 0.45
28 0.39
29 0.31
30 0.3
31 0.29
32 0.24
33 0.23
34 0.22
35 0.22
36 0.24
37 0.26
38 0.26
39 0.25
40 0.27
41 0.26
42 0.25
43 0.26
44 0.26
45 0.26
46 0.26
47 0.26
48 0.22
49 0.25
50 0.29
51 0.29
52 0.3
53 0.36
54 0.41
55 0.42
56 0.42
57 0.41
58 0.38
59 0.37
60 0.34
61 0.34
62 0.33
63 0.33
64 0.31
65 0.32
66 0.32
67 0.33
68 0.32
69 0.28
70 0.26
71 0.26
72 0.29
73 0.29
74 0.27
75 0.26
76 0.29
77 0.28
78 0.3
79 0.3
80 0.26
81 0.23
82 0.25
83 0.27
84 0.25
85 0.3
86 0.27
87 0.26
88 0.33
89 0.33
90 0.31
91 0.32
92 0.35
93 0.31
94 0.35
95 0.39
96 0.39
97 0.42
98 0.42
99 0.42
100 0.35
101 0.35
102 0.34
103 0.36
104 0.33
105 0.31
106 0.31
107 0.31
108 0.35
109 0.34
110 0.39