Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WNK7

Protein Details
Accession A0A0C9WNK7    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-26RRSSLSPTTKKNHRSRAQLKHFDKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRRSSLSPTTKKNHRSRAQLKHFDKIPVPRNNGTRSSTTIAFHSSIISLAPKEQGGEWLVICCLETAGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.82
4 0.84
5 0.86
6 0.87
7 0.8
8 0.77
9 0.72
10 0.64
11 0.58
12 0.55
13 0.54
14 0.51
15 0.53
16 0.5
17 0.52
18 0.52
19 0.51
20 0.46
21 0.38
22 0.35
23 0.32
24 0.29
25 0.25
26 0.22
27 0.2
28 0.19
29 0.17
30 0.13
31 0.11
32 0.09
33 0.09
34 0.09
35 0.07
36 0.07
37 0.09
38 0.08
39 0.09
40 0.09
41 0.11
42 0.12
43 0.13
44 0.12
45 0.12
46 0.12
47 0.11
48 0.11
49 0.09
50 0.08