Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WLV4

Protein Details
Accession A0A0C9WLV4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-35AGDIERQRRRAQNLRRRTQRFRVLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
Amino Acid Sequences MSLSNTELQGAGDIERQRRRAQNLRRRTQRFRVLIIGRANAGKTTILQRVCNTTEQPKIFNQMGHEIDLSELNPTAQRGEHDIENEMIFESNKAFVFHDSRGFEAGRTSELDKVKGFLQKLSSNSNLRDHLHVIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.33
4 0.38
5 0.44
6 0.52
7 0.57
8 0.64
9 0.67
10 0.72
11 0.8
12 0.84
13 0.86
14 0.86
15 0.85
16 0.84
17 0.78
18 0.71
19 0.69
20 0.61
21 0.6
22 0.54
23 0.46
24 0.37
25 0.33
26 0.29
27 0.2
28 0.19
29 0.12
30 0.1
31 0.13
32 0.17
33 0.18
34 0.19
35 0.2
36 0.24
37 0.26
38 0.27
39 0.25
40 0.25
41 0.29
42 0.29
43 0.3
44 0.26
45 0.28
46 0.27
47 0.26
48 0.23
49 0.22
50 0.22
51 0.2
52 0.19
53 0.15
54 0.14
55 0.13
56 0.11
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.06
65 0.09
66 0.12
67 0.13
68 0.13
69 0.14
70 0.14
71 0.14
72 0.14
73 0.1
74 0.09
75 0.08
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.09
82 0.11
83 0.15
84 0.16
85 0.22
86 0.21
87 0.21
88 0.23
89 0.22
90 0.2
91 0.19
92 0.18
93 0.14
94 0.15
95 0.16
96 0.19
97 0.21
98 0.23
99 0.21
100 0.22
101 0.24
102 0.27
103 0.26
104 0.24
105 0.28
106 0.31
107 0.34
108 0.38
109 0.41
110 0.41
111 0.44
112 0.47
113 0.45
114 0.43
115 0.44