Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XEU7

Protein Details
Accession A0A0C9XEU7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTKPKREKKQTKKAADGSPPTTHydrophilic
NLS Segment(s)
PositionSequence
5-12KREKKQTK
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MTKPKREKKQTKKAADGSPPTTHAPNIEWVKNPDWTWALINYLTDHPLFRKKLFSDSTAEANKEGTVTNHPHDLQLSFLTYANNPSLLQITLRRPYPQVSKAEHNNPGTTKAPIVPRLAKTPSPCLDIAYSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.8
4 0.74
5 0.67
6 0.6
7 0.53
8 0.46
9 0.38
10 0.3
11 0.25
12 0.28
13 0.3
14 0.29
15 0.3
16 0.32
17 0.34
18 0.36
19 0.35
20 0.3
21 0.26
22 0.24
23 0.23
24 0.19
25 0.19
26 0.15
27 0.15
28 0.14
29 0.14
30 0.14
31 0.12
32 0.12
33 0.13
34 0.19
35 0.21
36 0.2
37 0.25
38 0.25
39 0.31
40 0.33
41 0.33
42 0.3
43 0.3
44 0.34
45 0.3
46 0.3
47 0.23
48 0.21
49 0.19
50 0.14
51 0.13
52 0.08
53 0.1
54 0.12
55 0.13
56 0.15
57 0.16
58 0.15
59 0.16
60 0.15
61 0.13
62 0.11
63 0.11
64 0.09
65 0.09
66 0.1
67 0.09
68 0.11
69 0.1
70 0.1
71 0.09
72 0.09
73 0.1
74 0.09
75 0.11
76 0.13
77 0.18
78 0.21
79 0.23
80 0.24
81 0.24
82 0.28
83 0.34
84 0.36
85 0.38
86 0.39
87 0.45
88 0.51
89 0.57
90 0.6
91 0.55
92 0.52
93 0.47
94 0.47
95 0.41
96 0.35
97 0.29
98 0.27
99 0.3
100 0.3
101 0.35
102 0.36
103 0.38
104 0.43
105 0.46
106 0.46
107 0.46
108 0.5
109 0.48
110 0.46
111 0.43
112 0.39