Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WXJ6

Protein Details
Accession A0A0C9WXJ6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-90AWLRCSRRWRGQLKGRRTRKLERSSYFHydrophilic
NLS Segment(s)
PositionSequence
77-82KGRRTR
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRLAALRLFGNSLSQLLSTTGVTFATQHPPRHRTVSVRLVTSLYMITSIYKSPLLRAYYTNITAWLRCSRRWRGQLKGRRTRKLERSSYFVLNERTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.09
6 0.09
7 0.09
8 0.08
9 0.08
10 0.09
11 0.1
12 0.19
13 0.24
14 0.29
15 0.36
16 0.39
17 0.42
18 0.46
19 0.47
20 0.42
21 0.45
22 0.48
23 0.44
24 0.42
25 0.39
26 0.35
27 0.32
28 0.27
29 0.19
30 0.1
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.08
38 0.08
39 0.09
40 0.14
41 0.15
42 0.16
43 0.17
44 0.2
45 0.22
46 0.23
47 0.22
48 0.2
49 0.19
50 0.18
51 0.2
52 0.24
53 0.23
54 0.26
55 0.34
56 0.4
57 0.48
58 0.57
59 0.6
60 0.63
61 0.71
62 0.76
63 0.8
64 0.82
65 0.82
66 0.82
67 0.82
68 0.82
69 0.83
70 0.83
71 0.82
72 0.76
73 0.74
74 0.7
75 0.68
76 0.62
77 0.57