Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WJ72

Protein Details
Accession A0A0C9WJ72    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
111-131DLRPQPKPRPIAKKVVKQKKMBasic
NLS Segment(s)
PositionSequence
116-131PKPRPIAKKVVKQKKM
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, pero 3, mito 2
Family & Domain DBs
Amino Acid Sequences MYITTILKADPENEKLTDAELLQRAWKVQFSNVDVDKDCLALLEEEMFERSARAGVAGHCQWGLDIGDHDGWDLYRDVPGYFNHGDRAESESELQTGPHYKSVPVKVTQIDLRPQPKPRPIAKKVVKQKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.25
4 0.23
5 0.18
6 0.19
7 0.17
8 0.17
9 0.18
10 0.18
11 0.18
12 0.18
13 0.2
14 0.17
15 0.19
16 0.23
17 0.24
18 0.31
19 0.31
20 0.33
21 0.31
22 0.31
23 0.27
24 0.22
25 0.19
26 0.12
27 0.1
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.1
49 0.1
50 0.1
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.05
58 0.05
59 0.06
60 0.06
61 0.05
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.13
68 0.14
69 0.14
70 0.16
71 0.16
72 0.17
73 0.16
74 0.2
75 0.16
76 0.15
77 0.16
78 0.14
79 0.14
80 0.14
81 0.13
82 0.11
83 0.13
84 0.14
85 0.16
86 0.16
87 0.17
88 0.24
89 0.3
90 0.33
91 0.32
92 0.34
93 0.32
94 0.36
95 0.38
96 0.36
97 0.36
98 0.39
99 0.42
100 0.44
101 0.5
102 0.54
103 0.58
104 0.62
105 0.66
106 0.69
107 0.7
108 0.75
109 0.77
110 0.79
111 0.82