Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A4D9N1

Protein Details
Accession A4D9N1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-160ADAPKGKRRREWLIQTQNFRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR045875  NTF2  
IPR032710  NTF2-like_dom_sf  
IPR002075  NTF2_dom  
IPR018222  Nuclear_transport_factor_2_euk  
Gene Ontology GO:0044613  C:nuclear pore central transport channel  
GO:0006606  P:protein import into nucleus  
KEGG afm:AFUA_4G07835  -  
Pfam View protein in Pfam  
PF02136  NTF2  
PROSITE View protein in PROSITE  
PS50177  NTF2_DOMAIN  
Amino Acid Sequences MATRSEDVLTRVSTDAATEFVQSFYPALQSNRAAIASFYSQPTSTILFNGNAVADGNAVQEIFVNQMPPTHYEVQSFDCQVINPTYPTPTTSGVKLPNQTTVKDMSILVVVSGYVRFGESRDLPQRGFSETFMLVPNPTADAPKGKRRREWLIQTQNFRLVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.12
4 0.12
5 0.11
6 0.11
7 0.11
8 0.12
9 0.11
10 0.11
11 0.09
12 0.11
13 0.12
14 0.13
15 0.17
16 0.17
17 0.18
18 0.19
19 0.19
20 0.17
21 0.15
22 0.16
23 0.15
24 0.15
25 0.15
26 0.15
27 0.15
28 0.15
29 0.17
30 0.16
31 0.13
32 0.13
33 0.14
34 0.12
35 0.13
36 0.12
37 0.11
38 0.09
39 0.09
40 0.07
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.06
50 0.06
51 0.06
52 0.06
53 0.08
54 0.09
55 0.11
56 0.16
57 0.17
58 0.18
59 0.18
60 0.2
61 0.22
62 0.23
63 0.21
64 0.16
65 0.13
66 0.13
67 0.13
68 0.13
69 0.1
70 0.09
71 0.09
72 0.1
73 0.1
74 0.11
75 0.11
76 0.13
77 0.13
78 0.14
79 0.17
80 0.2
81 0.22
82 0.25
83 0.23
84 0.29
85 0.29
86 0.28
87 0.27
88 0.26
89 0.23
90 0.21
91 0.2
92 0.13
93 0.12
94 0.11
95 0.09
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.1
106 0.12
107 0.19
108 0.26
109 0.28
110 0.28
111 0.32
112 0.32
113 0.32
114 0.32
115 0.26
116 0.23
117 0.21
118 0.22
119 0.19
120 0.19
121 0.14
122 0.14
123 0.13
124 0.12
125 0.12
126 0.12
127 0.12
128 0.2
129 0.26
130 0.36
131 0.45
132 0.49
133 0.57
134 0.63
135 0.71
136 0.72
137 0.77
138 0.77
139 0.79
140 0.81
141 0.81
142 0.77