Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9Y5E2

Protein Details
Accession A0A0C9Y5E2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
472-502AAIPEKERKKEREKGDWRQRRNEKAMRTDIGBasic
NLS Segment(s)
PositionSequence
474-493IPEKERKKEREKGDWRQRRN
Subcellular Location(s) mito 14, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR042859  NOL11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030490  P:maturation of SSU-rRNA  
Amino Acid Sequences MQTLHRRSQARRVAPQDVLVFFQEGTDGTWHSYQLSISPPSNDQLPQLSPPFQLTGLSFISSPALKQSISLLALTSSHVLLSGVSPTSPSEINLLLWDLQYSILVTSQTLPIPTVLASNPLQLRLFPASTRSSEEGQIQTLLQDQALLLLSPSSKISDKMQSTSSVIVVPYAIPHTSTIAAAMGKAALSEQWIRNTPTTQTQPADLARTKLLGTMRRCNQAVSKLHICQRCTQHCSLNANERQQSPHFTIVVFTRGAEVPSREKGSVSIRSAFTAVLDLPESEIIECLRVVVVYHRQQHSADAMEVDSHPATAIPPLPSFLSLCTTYPTSQKYLLLALRQHLREIEDIMCVAQILDDWVSKWGARRAAGEERLLPSKKDLRKNEYGMWVVVGRKYAGKKQDELPPLEKVLAFLQTLMDASFLSLLQYPPAHQILKHLRAQLEPEVAFAELVEHLRGPLEPFAVGHEKALKEAAIPEKERKKEREKGDWRQRRNEKAMRTDIGVYQIEELVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.66
3 0.6
4 0.51
5 0.44
6 0.36
7 0.3
8 0.23
9 0.21
10 0.16
11 0.11
12 0.12
13 0.11
14 0.11
15 0.13
16 0.14
17 0.14
18 0.15
19 0.16
20 0.14
21 0.15
22 0.19
23 0.21
24 0.22
25 0.25
26 0.26
27 0.26
28 0.29
29 0.27
30 0.24
31 0.24
32 0.25
33 0.27
34 0.29
35 0.3
36 0.28
37 0.29
38 0.28
39 0.24
40 0.23
41 0.19
42 0.19
43 0.18
44 0.18
45 0.15
46 0.14
47 0.16
48 0.15
49 0.14
50 0.14
51 0.14
52 0.13
53 0.14
54 0.16
55 0.18
56 0.19
57 0.19
58 0.15
59 0.14
60 0.15
61 0.15
62 0.14
63 0.09
64 0.08
65 0.08
66 0.08
67 0.07
68 0.08
69 0.09
70 0.08
71 0.08
72 0.09
73 0.09
74 0.11
75 0.11
76 0.11
77 0.11
78 0.12
79 0.12
80 0.13
81 0.14
82 0.12
83 0.12
84 0.11
85 0.09
86 0.08
87 0.08
88 0.08
89 0.06
90 0.07
91 0.07
92 0.07
93 0.08
94 0.1
95 0.11
96 0.11
97 0.11
98 0.1
99 0.11
100 0.1
101 0.11
102 0.09
103 0.12
104 0.13
105 0.17
106 0.17
107 0.19
108 0.19
109 0.17
110 0.2
111 0.2
112 0.2
113 0.16
114 0.19
115 0.2
116 0.22
117 0.27
118 0.26
119 0.24
120 0.25
121 0.29
122 0.26
123 0.24
124 0.23
125 0.18
126 0.16
127 0.16
128 0.15
129 0.1
130 0.09
131 0.08
132 0.08
133 0.08
134 0.08
135 0.05
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.09
142 0.1
143 0.14
144 0.21
145 0.23
146 0.25
147 0.26
148 0.26
149 0.27
150 0.26
151 0.23
152 0.17
153 0.14
154 0.12
155 0.11
156 0.09
157 0.08
158 0.08
159 0.07
160 0.07
161 0.07
162 0.09
163 0.09
164 0.09
165 0.08
166 0.08
167 0.08
168 0.07
169 0.07
170 0.06
171 0.05
172 0.05
173 0.04
174 0.03
175 0.05
176 0.09
177 0.11
178 0.14
179 0.17
180 0.19
181 0.2
182 0.21
183 0.21
184 0.25
185 0.27
186 0.28
187 0.26
188 0.25
189 0.26
190 0.26
191 0.29
192 0.23
193 0.21
194 0.17
195 0.17
196 0.16
197 0.17
198 0.19
199 0.21
200 0.24
201 0.31
202 0.35
203 0.39
204 0.39
205 0.37
206 0.37
207 0.38
208 0.38
209 0.36
210 0.36
211 0.35
212 0.4
213 0.43
214 0.41
215 0.39
216 0.44
217 0.44
218 0.45
219 0.44
220 0.43
221 0.45
222 0.47
223 0.44
224 0.45
225 0.43
226 0.41
227 0.42
228 0.38
229 0.36
230 0.33
231 0.34
232 0.27
233 0.26
234 0.22
235 0.18
236 0.19
237 0.16
238 0.17
239 0.14
240 0.1
241 0.1
242 0.09
243 0.1
244 0.1
245 0.11
246 0.11
247 0.14
248 0.16
249 0.15
250 0.14
251 0.16
252 0.2
253 0.24
254 0.23
255 0.25
256 0.23
257 0.24
258 0.24
259 0.22
260 0.17
261 0.12
262 0.1
263 0.06
264 0.06
265 0.06
266 0.05
267 0.06
268 0.06
269 0.05
270 0.05
271 0.05
272 0.05
273 0.05
274 0.04
275 0.04
276 0.04
277 0.04
278 0.07
279 0.14
280 0.19
281 0.25
282 0.26
283 0.28
284 0.28
285 0.3
286 0.28
287 0.23
288 0.18
289 0.12
290 0.11
291 0.11
292 0.1
293 0.11
294 0.08
295 0.07
296 0.06
297 0.06
298 0.06
299 0.06
300 0.09
301 0.09
302 0.09
303 0.1
304 0.1
305 0.11
306 0.11
307 0.11
308 0.12
309 0.11
310 0.11
311 0.13
312 0.14
313 0.15
314 0.18
315 0.2
316 0.2
317 0.2
318 0.21
319 0.2
320 0.22
321 0.23
322 0.22
323 0.22
324 0.23
325 0.27
326 0.27
327 0.26
328 0.23
329 0.23
330 0.2
331 0.21
332 0.18
333 0.12
334 0.12
335 0.11
336 0.1
337 0.08
338 0.07
339 0.05
340 0.04
341 0.04
342 0.05
343 0.05
344 0.06
345 0.07
346 0.08
347 0.09
348 0.12
349 0.16
350 0.18
351 0.2
352 0.21
353 0.26
354 0.33
355 0.35
356 0.33
357 0.32
358 0.32
359 0.37
360 0.36
361 0.31
362 0.28
363 0.34
364 0.4
365 0.47
366 0.52
367 0.54
368 0.61
369 0.66
370 0.66
371 0.63
372 0.57
373 0.48
374 0.42
375 0.36
376 0.29
377 0.25
378 0.2
379 0.15
380 0.17
381 0.2
382 0.25
383 0.31
384 0.33
385 0.36
386 0.4
387 0.48
388 0.49
389 0.52
390 0.49
391 0.44
392 0.42
393 0.4
394 0.34
395 0.27
396 0.23
397 0.19
398 0.16
399 0.13
400 0.12
401 0.11
402 0.11
403 0.1
404 0.08
405 0.06
406 0.06
407 0.06
408 0.06
409 0.06
410 0.08
411 0.08
412 0.1
413 0.11
414 0.12
415 0.16
416 0.2
417 0.19
418 0.18
419 0.27
420 0.35
421 0.41
422 0.45
423 0.45
424 0.43
425 0.44
426 0.48
427 0.44
428 0.4
429 0.33
430 0.29
431 0.25
432 0.24
433 0.21
434 0.17
435 0.13
436 0.08
437 0.09
438 0.09
439 0.08
440 0.08
441 0.09
442 0.1
443 0.11
444 0.12
445 0.12
446 0.12
447 0.12
448 0.17
449 0.21
450 0.21
451 0.21
452 0.24
453 0.24
454 0.24
455 0.26
456 0.2
457 0.17
458 0.22
459 0.28
460 0.29
461 0.33
462 0.42
463 0.49
464 0.57
465 0.64
466 0.67
467 0.69
468 0.71
469 0.76
470 0.78
471 0.8
472 0.83
473 0.86
474 0.88
475 0.87
476 0.89
477 0.9
478 0.89
479 0.89
480 0.86
481 0.84
482 0.83
483 0.82
484 0.75
485 0.68
486 0.61
487 0.53
488 0.51
489 0.43
490 0.34
491 0.27