Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9X7P7

Protein Details
Accession A0A0C9X7P7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-39SEARATFRPRRSKKNTRSSRSSDSHydrophilic
NLS Segment(s)
PositionSequence
24-29PRRSKK
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGAGQLMWHGELLKASEARATFRPRRSKKNTRSSRSSDSERNPWAVKAVSRQFTAVVVLEGSGHREYTGLVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.14
5 0.17
6 0.22
7 0.28
8 0.32
9 0.4
10 0.51
11 0.54
12 0.64
13 0.71
14 0.77
15 0.79
16 0.83
17 0.86
18 0.82
19 0.84
20 0.8
21 0.78
22 0.72
23 0.67
24 0.62
25 0.56
26 0.55
27 0.49
28 0.45
29 0.38
30 0.33
31 0.3
32 0.24
33 0.22
34 0.23
35 0.28
36 0.28
37 0.28
38 0.28
39 0.27
40 0.26
41 0.26
42 0.18
43 0.12
44 0.09
45 0.08
46 0.09
47 0.08
48 0.11
49 0.1
50 0.1
51 0.1
52 0.1