Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XNI7

Protein Details
Accession A0A0C9XNI7    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-90NKTKGGRDGKKSREKERRKGRKQRKARKTSAMKADEDBasic
NLS Segment(s)
PositionSequence
24-43KPPRKRANTAASKNTSKRPK
55-82KTKGGRDGKKSREKERRKGRKQRKARKT
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MPTTCANIPTTRSGHACLSPPVSKPPRKRANTAASKNTSKRPKPNMDDDETEGNKTKGGRDGKKSREKERRKGRKQRKARKTSAMKADEDAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.31
4 0.28
5 0.31
6 0.3
7 0.3
8 0.37
9 0.42
10 0.47
11 0.53
12 0.6
13 0.65
14 0.67
15 0.71
16 0.7
17 0.72
18 0.75
19 0.73
20 0.71
21 0.66
22 0.67
23 0.65
24 0.64
25 0.62
26 0.58
27 0.59
28 0.6
29 0.63
30 0.62
31 0.69
32 0.66
33 0.61
34 0.58
35 0.52
36 0.49
37 0.41
38 0.37
39 0.28
40 0.23
41 0.2
42 0.18
43 0.16
44 0.17
45 0.25
46 0.3
47 0.38
48 0.47
49 0.56
50 0.66
51 0.7
52 0.74
53 0.77
54 0.8
55 0.82
56 0.84
57 0.86
58 0.87
59 0.92
60 0.93
61 0.93
62 0.95
63 0.95
64 0.95
65 0.94
66 0.92
67 0.91
68 0.9
69 0.89
70 0.88
71 0.82
72 0.73
73 0.64