Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q4WGU7

Protein Details
Accession Q4WGU7    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-22VQPPCKKCKKAGLECFEQRPLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, nucl 3, mito 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0000976  F:transcription cis-regulatory region binding  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
KEGG afm:AFUA_7G06280  -  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MVQPPCKKCKKAGLECFEQRPLRWAEGATYRGKTRTSSAKKDVPSSAAGANPRTTRTGGQTLSKSRNLSLIAGADLKDSKCVCKLFIMYDSNRNPLRNLIPAALAHPVLLMSILALSARHKANAARPFYQSESARPSGLGSQDDSYNALYFKCNAIQRLARALGAARPYHKDIIAASAFLLIFLDLLESGSDKWNFHLEGIKSLIAQIPSPQAPRTIASHDLGTTIQGLRDFILRQIYLYEVRMMLDSTQSFDCHTWASSLLQPHSSAESLGMLEKVAQSYKLGALIYGKRVFDALTGDTSPHHDLACDLIRVIDALRSSDSLFKCILWPLFVAGLESQQEAHRHFVATCLEKFWFETKCLNAVNAGMILRRFWKRDDSGNISSTQWIFNIGQVEGDWLLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.81
4 0.78
5 0.7
6 0.59
7 0.56
8 0.52
9 0.45
10 0.4
11 0.34
12 0.31
13 0.36
14 0.39
15 0.37
16 0.37
17 0.37
18 0.37
19 0.38
20 0.35
21 0.34
22 0.41
23 0.45
24 0.51
25 0.56
26 0.61
27 0.63
28 0.67
29 0.64
30 0.56
31 0.49
32 0.42
33 0.36
34 0.33
35 0.32
36 0.29
37 0.3
38 0.29
39 0.29
40 0.28
41 0.28
42 0.27
43 0.3
44 0.35
45 0.33
46 0.38
47 0.43
48 0.48
49 0.52
50 0.54
51 0.49
52 0.43
53 0.44
54 0.39
55 0.34
56 0.28
57 0.23
58 0.2
59 0.19
60 0.19
61 0.16
62 0.17
63 0.15
64 0.18
65 0.17
66 0.18
67 0.21
68 0.22
69 0.22
70 0.24
71 0.26
72 0.24
73 0.3
74 0.35
75 0.33
76 0.41
77 0.42
78 0.44
79 0.45
80 0.43
81 0.37
82 0.35
83 0.36
84 0.31
85 0.31
86 0.26
87 0.25
88 0.24
89 0.24
90 0.21
91 0.18
92 0.13
93 0.1
94 0.09
95 0.07
96 0.07
97 0.05
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.05
104 0.09
105 0.1
106 0.11
107 0.12
108 0.15
109 0.23
110 0.3
111 0.34
112 0.32
113 0.34
114 0.37
115 0.39
116 0.42
117 0.36
118 0.32
119 0.34
120 0.32
121 0.3
122 0.27
123 0.25
124 0.21
125 0.22
126 0.19
127 0.14
128 0.14
129 0.14
130 0.15
131 0.15
132 0.12
133 0.11
134 0.1
135 0.09
136 0.09
137 0.09
138 0.1
139 0.14
140 0.15
141 0.16
142 0.19
143 0.21
144 0.22
145 0.26
146 0.25
147 0.21
148 0.19
149 0.18
150 0.17
151 0.18
152 0.17
153 0.14
154 0.17
155 0.19
156 0.2
157 0.19
158 0.17
159 0.14
160 0.19
161 0.17
162 0.14
163 0.12
164 0.12
165 0.11
166 0.1
167 0.1
168 0.04
169 0.04
170 0.04
171 0.04
172 0.02
173 0.03
174 0.03
175 0.03
176 0.04
177 0.07
178 0.08
179 0.08
180 0.09
181 0.11
182 0.11
183 0.12
184 0.16
185 0.14
186 0.15
187 0.17
188 0.16
189 0.14
190 0.14
191 0.16
192 0.1
193 0.1
194 0.09
195 0.1
196 0.11
197 0.12
198 0.12
199 0.12
200 0.13
201 0.14
202 0.15
203 0.15
204 0.16
205 0.16
206 0.16
207 0.15
208 0.15
209 0.14
210 0.12
211 0.1
212 0.08
213 0.07
214 0.07
215 0.07
216 0.07
217 0.08
218 0.09
219 0.09
220 0.12
221 0.11
222 0.11
223 0.11
224 0.12
225 0.12
226 0.12
227 0.12
228 0.09
229 0.1
230 0.1
231 0.09
232 0.08
233 0.09
234 0.08
235 0.1
236 0.1
237 0.1
238 0.11
239 0.11
240 0.12
241 0.1
242 0.11
243 0.09
244 0.1
245 0.11
246 0.13
247 0.16
248 0.16
249 0.17
250 0.17
251 0.17
252 0.18
253 0.16
254 0.13
255 0.1
256 0.1
257 0.09
258 0.09
259 0.08
260 0.06
261 0.06
262 0.07
263 0.08
264 0.07
265 0.07
266 0.07
267 0.08
268 0.09
269 0.11
270 0.1
271 0.09
272 0.14
273 0.16
274 0.21
275 0.23
276 0.22
277 0.21
278 0.21
279 0.21
280 0.17
281 0.17
282 0.13
283 0.12
284 0.13
285 0.13
286 0.13
287 0.17
288 0.18
289 0.16
290 0.14
291 0.12
292 0.12
293 0.16
294 0.19
295 0.15
296 0.13
297 0.13
298 0.13
299 0.13
300 0.13
301 0.1
302 0.08
303 0.09
304 0.1
305 0.11
306 0.12
307 0.19
308 0.19
309 0.19
310 0.19
311 0.18
312 0.19
313 0.22
314 0.22
315 0.16
316 0.16
317 0.15
318 0.16
319 0.16
320 0.16
321 0.12
322 0.13
323 0.13
324 0.13
325 0.12
326 0.13
327 0.17
328 0.17
329 0.21
330 0.2
331 0.2
332 0.2
333 0.23
334 0.27
335 0.29
336 0.28
337 0.28
338 0.27
339 0.26
340 0.29
341 0.3
342 0.26
343 0.23
344 0.28
345 0.28
346 0.32
347 0.33
348 0.31
349 0.27
350 0.25
351 0.24
352 0.2
353 0.18
354 0.15
355 0.14
356 0.15
357 0.2
358 0.24
359 0.25
360 0.26
361 0.35
362 0.37
363 0.46
364 0.53
365 0.56
366 0.57
367 0.57
368 0.55
369 0.48
370 0.47
371 0.4
372 0.32
373 0.23
374 0.21
375 0.19
376 0.2
377 0.22
378 0.18
379 0.17
380 0.16
381 0.19