Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WR40

Protein Details
Accession A0A0C9WR40    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
56-86ESNAHHPREDPKRNKKERDALVKQREKNSRHBasic
NLS Segment(s)
PositionSequence
66-80PKRNKKERDALVKQR
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
Amino Acid Sequences ITFPVARPTSIINSRAGSKGIIKCNPLSVALKKSAMFDVISSSTTTTMSISSVNSESNAHHPREDPKRNKKERDALVKQREKNSRHGTLEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.3
4 0.24
5 0.25
6 0.29
7 0.34
8 0.35
9 0.35
10 0.34
11 0.36
12 0.36
13 0.31
14 0.29
15 0.26
16 0.26
17 0.26
18 0.27
19 0.25
20 0.25
21 0.23
22 0.2
23 0.16
24 0.12
25 0.12
26 0.11
27 0.12
28 0.1
29 0.1
30 0.09
31 0.09
32 0.09
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.08
40 0.08
41 0.08
42 0.09
43 0.09
44 0.17
45 0.21
46 0.21
47 0.21
48 0.23
49 0.3
50 0.4
51 0.49
52 0.52
53 0.59
54 0.69
55 0.78
56 0.84
57 0.85
58 0.85
59 0.83
60 0.84
61 0.83
62 0.82
63 0.84
64 0.84
65 0.81
66 0.81
67 0.8
68 0.73
69 0.73
70 0.71
71 0.69
72 0.67