Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WVF8

Protein Details
Accession A0A0C9WVF8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-53GKSTKKGKSGGKKGKKARMTBasic
NLS Segment(s)
PositionSequence
34-60GKSTKKGKSGGKKGKKARMTGAQRAAR
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences KRGQSNTEATTTKRAKPTTKNDVEGSGEEEPEAGKSTKKGKSGGKKGKKARMTGAQRAARDKAENDKGVPAHLTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.56
4 0.63
5 0.64
6 0.67
7 0.65
8 0.59
9 0.57
10 0.52
11 0.43
12 0.38
13 0.28
14 0.21
15 0.16
16 0.15
17 0.12
18 0.1
19 0.11
20 0.07
21 0.07
22 0.1
23 0.17
24 0.21
25 0.23
26 0.28
27 0.33
28 0.43
29 0.54
30 0.62
31 0.66
32 0.71
33 0.77
34 0.81
35 0.79
36 0.72
37 0.68
38 0.67
39 0.65
40 0.65
41 0.66
42 0.62
43 0.59
44 0.6
45 0.56
46 0.48
47 0.43
48 0.38
49 0.37
50 0.4
51 0.4
52 0.38
53 0.41
54 0.38
55 0.37