Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WGS8

Protein Details
Accession A0A0C9WGS8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
23-49YCGRECQKADWKKHRKWCKKDLDLTTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 14, nucl 13.5, mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences MMKPEGSLLRCAGSCARIRKPRYCGRECQKADWKKHRKWCKKDLDLTTPNEADEEMFYNMHMTNDISSQSRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.38
4 0.44
5 0.5
6 0.55
7 0.62
8 0.66
9 0.69
10 0.68
11 0.69
12 0.68
13 0.73
14 0.68
15 0.68
16 0.68
17 0.67
18 0.71
19 0.72
20 0.74
21 0.7
22 0.78
23 0.81
24 0.81
25 0.82
26 0.83
27 0.83
28 0.82
29 0.83
30 0.8
31 0.79
32 0.74
33 0.69
34 0.63
35 0.52
36 0.44
37 0.35
38 0.28
39 0.19
40 0.15
41 0.14
42 0.1
43 0.1
44 0.1
45 0.11
46 0.12
47 0.11
48 0.11
49 0.09
50 0.09
51 0.11
52 0.13