Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Y0U3

Protein Details
Accession A0A0C9Y0U3    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MQNPRHRRRPRLVLYKQPHLAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013594  Dynein_heavy_tail  
Pfam View protein in Pfam  
PF08385  DHC_N1  
Amino Acid Sequences MQNPRHRRRPRLVLYKQPHLAQFRTIITPIGAWSGFARCVLLVAAPDSTGLVSDIPSKLLTDSTFLNSLHSHVNTWIKAIQAVTKLTRDVSSGTASLEINFWMSLEGVGRDRKTAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.79
4 0.71
5 0.67
6 0.6
7 0.52
8 0.44
9 0.41
10 0.34
11 0.31
12 0.29
13 0.24
14 0.19
15 0.18
16 0.15
17 0.14
18 0.11
19 0.09
20 0.09
21 0.1
22 0.1
23 0.1
24 0.09
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.06
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.07
48 0.07
49 0.08
50 0.09
51 0.11
52 0.11
53 0.12
54 0.11
55 0.13
56 0.14
57 0.13
58 0.12
59 0.14
60 0.18
61 0.16
62 0.18
63 0.17
64 0.15
65 0.16
66 0.15
67 0.15
68 0.14
69 0.17
70 0.17
71 0.17
72 0.18
73 0.18
74 0.18
75 0.16
76 0.15
77 0.15
78 0.15
79 0.14
80 0.14
81 0.15
82 0.14
83 0.14
84 0.13
85 0.11
86 0.09
87 0.09
88 0.08
89 0.07
90 0.07
91 0.07
92 0.08
93 0.1
94 0.12
95 0.18
96 0.19
97 0.2