Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WK11

Protein Details
Accession A0A0C9WK11    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLSRTTRRQKHKIRDIDRSLKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MLSRTTRRQKHKIRDIDRSLKATNVVSNFYFSPAPNKQHFRCTEKLHHILDLISVSLTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.79
5 0.72
6 0.63
7 0.53
8 0.47
9 0.37
10 0.31
11 0.23
12 0.2
13 0.16
14 0.17
15 0.16
16 0.15
17 0.15
18 0.12
19 0.17
20 0.2
21 0.24
22 0.29
23 0.36
24 0.36
25 0.44
26 0.49
27 0.49
28 0.52
29 0.54
30 0.58
31 0.6
32 0.65
33 0.58
34 0.53
35 0.47
36 0.41
37 0.35
38 0.27
39 0.18