Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WV81

Protein Details
Accession Q4WV81    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-79PTPADNRERRRMHRVRKKEYFLRKQKPKPLSAREKRISBasic
211-231QFENRPVDRANKKFKWRNVDYHydrophilic
NLS Segment(s)
PositionSequence
48-77RERRRMHRVRKKEYFLRKQKPKPLSAREKR
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000172  C:ribonuclease MRP complex  
GO:0030677  C:ribonuclease P complex  
GO:0033204  F:ribonuclease P RNA binding  
GO:0006364  P:rRNA processing  
GO:0001682  P:tRNA 5'-leader removal  
KEGG afm:AFUA_5G11150  -  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MTTPKPHIARELLARAHSPDTAEQLFTERVKQKPLYLRPTSPTPADNRERRRMHRVRKKEYFLRKQKPKPLSAREKRISGLYDLPKEECKYSIFQELHKLWVGYMQEILDLRVRKVPITPQSHGSKLVTADFHGAEVEVVRSRCPGRVGVKGIVARDTKFTFMIVTKKDEVKKQTIFRFTVPLPSADDEDTAMSYGDTAKKALTFELHGSQFENRPVDRANKKFKWRNVDYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.38
3 0.36
4 0.32
5 0.27
6 0.21
7 0.24
8 0.23
9 0.22
10 0.2
11 0.21
12 0.24
13 0.22
14 0.29
15 0.29
16 0.3
17 0.36
18 0.37
19 0.41
20 0.47
21 0.55
22 0.57
23 0.58
24 0.6
25 0.58
26 0.63
27 0.59
28 0.52
29 0.47
30 0.42
31 0.45
32 0.49
33 0.53
34 0.55
35 0.61
36 0.66
37 0.69
38 0.74
39 0.76
40 0.78
41 0.8
42 0.82
43 0.83
44 0.85
45 0.87
46 0.86
47 0.87
48 0.87
49 0.87
50 0.87
51 0.87
52 0.86
53 0.87
54 0.85
55 0.83
56 0.81
57 0.81
58 0.81
59 0.8
60 0.82
61 0.76
62 0.71
63 0.64
64 0.57
65 0.48
66 0.39
67 0.38
68 0.32
69 0.31
70 0.3
71 0.3
72 0.3
73 0.3
74 0.28
75 0.21
76 0.18
77 0.17
78 0.18
79 0.25
80 0.23
81 0.23
82 0.3
83 0.29
84 0.29
85 0.28
86 0.26
87 0.17
88 0.2
89 0.19
90 0.12
91 0.11
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.1
98 0.11
99 0.13
100 0.13
101 0.13
102 0.14
103 0.18
104 0.23
105 0.29
106 0.29
107 0.32
108 0.35
109 0.36
110 0.36
111 0.31
112 0.24
113 0.19
114 0.2
115 0.14
116 0.12
117 0.12
118 0.11
119 0.1
120 0.09
121 0.08
122 0.06
123 0.06
124 0.06
125 0.07
126 0.07
127 0.08
128 0.1
129 0.1
130 0.12
131 0.14
132 0.17
133 0.19
134 0.25
135 0.29
136 0.29
137 0.32
138 0.32
139 0.31
140 0.31
141 0.28
142 0.23
143 0.23
144 0.22
145 0.19
146 0.17
147 0.17
148 0.14
149 0.15
150 0.21
151 0.19
152 0.23
153 0.25
154 0.3
155 0.34
156 0.38
157 0.41
158 0.42
159 0.47
160 0.5
161 0.54
162 0.55
163 0.54
164 0.5
165 0.5
166 0.43
167 0.44
168 0.38
169 0.32
170 0.28
171 0.28
172 0.28
173 0.23
174 0.23
175 0.15
176 0.15
177 0.14
178 0.11
179 0.09
180 0.07
181 0.07
182 0.09
183 0.12
184 0.12
185 0.12
186 0.12
187 0.14
188 0.15
189 0.16
190 0.16
191 0.16
192 0.19
193 0.25
194 0.26
195 0.25
196 0.26
197 0.28
198 0.3
199 0.32
200 0.32
201 0.26
202 0.28
203 0.31
204 0.39
205 0.45
206 0.5
207 0.56
208 0.6
209 0.71
210 0.77
211 0.81
212 0.82