Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Y0Q1

Protein Details
Accession A0A0C9Y0Q1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-92EEASKKFIKAERKRDRNKSQYAYLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028133  Dynamitin  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005869  C:dynactin complex  
GO:0007017  P:microtubule-based process  
Pfam View protein in Pfam  
PF04912  Dynamitin  
Amino Acid Sequences MSGNKYADLPDIDTAPDIYETEDIFPSSHPNDGGSSDEDVAIARSTVKSRTDLNMGDELDLSNLLAAEEASKKFIKAERKRDRNKSQYAYLHSPTFPPSPTATVKSRNPPLSQRLRALQSELASLEEELSDPSNPLLQKERDVESLDPGELIRGLVDVRGRLEKIRKEKEGRSRLVGVIIGDAGSVDRGEQDKENQRIEDTKSSSDKTLHTVVDMDRRVGELEKLVGASSATLDETSPLPSPLLPLITRLNSQLTLLTQPRHIDSISRRLKLLLSDLDRASAAQHHRRHPSQPIAIPQSSPLSEQLLPLLSRLGPSLPHIPHILARLRTLSMLHTAAADFQNLLGDLEQDQKKMRSALEELEEAVCTIEKSMEDNRQVVKGNVTGLEDRVSMLLKRLQDARLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.14
4 0.11
5 0.11
6 0.12
7 0.12
8 0.14
9 0.14
10 0.14
11 0.14
12 0.14
13 0.18
14 0.18
15 0.2
16 0.18
17 0.18
18 0.19
19 0.2
20 0.22
21 0.19
22 0.2
23 0.18
24 0.18
25 0.17
26 0.15
27 0.15
28 0.12
29 0.1
30 0.09
31 0.1
32 0.12
33 0.16
34 0.19
35 0.2
36 0.24
37 0.28
38 0.32
39 0.32
40 0.34
41 0.35
42 0.33
43 0.31
44 0.28
45 0.24
46 0.19
47 0.17
48 0.12
49 0.07
50 0.06
51 0.05
52 0.05
53 0.04
54 0.06
55 0.1
56 0.11
57 0.14
58 0.15
59 0.15
60 0.19
61 0.24
62 0.33
63 0.39
64 0.5
65 0.58
66 0.68
67 0.78
68 0.85
69 0.91
70 0.9
71 0.9
72 0.85
73 0.82
74 0.78
75 0.76
76 0.72
77 0.65
78 0.58
79 0.49
80 0.44
81 0.39
82 0.35
83 0.28
84 0.24
85 0.22
86 0.24
87 0.26
88 0.3
89 0.31
90 0.35
91 0.41
92 0.46
93 0.52
94 0.52
95 0.52
96 0.54
97 0.59
98 0.62
99 0.61
100 0.56
101 0.54
102 0.53
103 0.5
104 0.47
105 0.4
106 0.31
107 0.27
108 0.23
109 0.18
110 0.15
111 0.14
112 0.11
113 0.08
114 0.07
115 0.06
116 0.07
117 0.07
118 0.06
119 0.07
120 0.1
121 0.1
122 0.11
123 0.17
124 0.17
125 0.21
126 0.24
127 0.27
128 0.26
129 0.28
130 0.27
131 0.24
132 0.24
133 0.2
134 0.17
135 0.14
136 0.12
137 0.09
138 0.08
139 0.05
140 0.04
141 0.04
142 0.05
143 0.06
144 0.06
145 0.08
146 0.1
147 0.11
148 0.14
149 0.2
150 0.25
151 0.34
152 0.4
153 0.45
154 0.49
155 0.56
156 0.64
157 0.67
158 0.63
159 0.57
160 0.53
161 0.47
162 0.42
163 0.35
164 0.25
165 0.16
166 0.13
167 0.09
168 0.06
169 0.05
170 0.04
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.06
177 0.07
178 0.13
179 0.2
180 0.24
181 0.26
182 0.25
183 0.25
184 0.27
185 0.29
186 0.3
187 0.24
188 0.24
189 0.25
190 0.26
191 0.26
192 0.25
193 0.23
194 0.2
195 0.22
196 0.18
197 0.16
198 0.17
199 0.17
200 0.22
201 0.21
202 0.18
203 0.15
204 0.15
205 0.16
206 0.14
207 0.13
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.06
214 0.05
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.05
222 0.06
223 0.08
224 0.08
225 0.08
226 0.08
227 0.08
228 0.09
229 0.09
230 0.11
231 0.09
232 0.11
233 0.13
234 0.15
235 0.15
236 0.16
237 0.16
238 0.14
239 0.15
240 0.13
241 0.11
242 0.15
243 0.16
244 0.16
245 0.17
246 0.18
247 0.18
248 0.19
249 0.18
250 0.19
251 0.21
252 0.3
253 0.35
254 0.35
255 0.34
256 0.34
257 0.35
258 0.31
259 0.31
260 0.27
261 0.24
262 0.27
263 0.26
264 0.26
265 0.25
266 0.24
267 0.2
268 0.18
269 0.21
270 0.25
271 0.32
272 0.37
273 0.45
274 0.48
275 0.52
276 0.55
277 0.57
278 0.56
279 0.54
280 0.55
281 0.55
282 0.52
283 0.48
284 0.42
285 0.37
286 0.3
287 0.27
288 0.2
289 0.18
290 0.17
291 0.17
292 0.17
293 0.16
294 0.16
295 0.15
296 0.15
297 0.11
298 0.11
299 0.12
300 0.11
301 0.09
302 0.12
303 0.2
304 0.19
305 0.21
306 0.22
307 0.22
308 0.24
309 0.28
310 0.31
311 0.25
312 0.26
313 0.26
314 0.25
315 0.25
316 0.23
317 0.2
318 0.18
319 0.17
320 0.16
321 0.14
322 0.13
323 0.16
324 0.16
325 0.14
326 0.1
327 0.1
328 0.1
329 0.1
330 0.1
331 0.07
332 0.08
333 0.08
334 0.17
335 0.18
336 0.19
337 0.22
338 0.23
339 0.26
340 0.28
341 0.28
342 0.25
343 0.27
344 0.3
345 0.31
346 0.3
347 0.28
348 0.26
349 0.25
350 0.2
351 0.18
352 0.13
353 0.09
354 0.09
355 0.09
356 0.08
357 0.12
358 0.18
359 0.25
360 0.28
361 0.32
362 0.34
363 0.37
364 0.39
365 0.37
366 0.34
367 0.29
368 0.28
369 0.26
370 0.27
371 0.24
372 0.23
373 0.24
374 0.2
375 0.18
376 0.17
377 0.17
378 0.14
379 0.17
380 0.2
381 0.2
382 0.24
383 0.28