Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WCM1

Protein Details
Accession Q4WCM1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-72FSSSPSLCKKKDKSRKLTGANTELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002661  Ribosome_recyc_fac  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0043023  F:ribosomal large subunit binding  
GO:0006412  P:translation  
KEGG afm:AFUA_8G03940  -  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MQRIQRLSILSDIPRSFYSANSSPIVLDARQPWRFLPPSERFNLTTRSFSSSPSLCKKKDKSRKLTGANTELSIPSEDPYDLSSLENGIVAAVARLKDELSKLRMGGRFNTESLEDLRVSLGKGGKEIVRLGELAQVVPKGGRTVTILASEEEHVKPITSAILSSDLSLTPQPDPHNILQLNISIPPPTKELREQTVVAARAAMEKAAGAVRESRSVSHKRLQDMQKKKLARPDDVRKAQDHMERLTEKGQKEVKELFDAAKRALERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.27
4 0.24
5 0.3
6 0.26
7 0.3
8 0.28
9 0.28
10 0.24
11 0.26
12 0.27
13 0.19
14 0.19
15 0.22
16 0.3
17 0.32
18 0.33
19 0.32
20 0.37
21 0.4
22 0.39
23 0.42
24 0.41
25 0.45
26 0.48
27 0.51
28 0.46
29 0.47
30 0.51
31 0.43
32 0.4
33 0.36
34 0.39
35 0.35
36 0.34
37 0.36
38 0.33
39 0.37
40 0.43
41 0.48
42 0.44
43 0.53
44 0.61
45 0.66
46 0.74
47 0.77
48 0.77
49 0.81
50 0.87
51 0.86
52 0.85
53 0.81
54 0.76
55 0.67
56 0.58
57 0.48
58 0.39
59 0.31
60 0.24
61 0.17
62 0.11
63 0.11
64 0.1
65 0.09
66 0.1
67 0.1
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.07
85 0.09
86 0.13
87 0.15
88 0.16
89 0.16
90 0.21
91 0.24
92 0.25
93 0.26
94 0.27
95 0.26
96 0.25
97 0.26
98 0.2
99 0.19
100 0.19
101 0.18
102 0.12
103 0.1
104 0.1
105 0.1
106 0.09
107 0.11
108 0.11
109 0.09
110 0.1
111 0.11
112 0.11
113 0.12
114 0.12
115 0.1
116 0.09
117 0.09
118 0.09
119 0.1
120 0.1
121 0.08
122 0.09
123 0.08
124 0.07
125 0.07
126 0.07
127 0.05
128 0.05
129 0.05
130 0.06
131 0.08
132 0.09
133 0.1
134 0.11
135 0.11
136 0.12
137 0.12
138 0.13
139 0.11
140 0.11
141 0.1
142 0.09
143 0.09
144 0.08
145 0.08
146 0.06
147 0.06
148 0.06
149 0.08
150 0.08
151 0.09
152 0.09
153 0.08
154 0.09
155 0.1
156 0.1
157 0.08
158 0.11
159 0.12
160 0.14
161 0.19
162 0.18
163 0.25
164 0.24
165 0.24
166 0.22
167 0.22
168 0.2
169 0.17
170 0.17
171 0.11
172 0.11
173 0.12
174 0.14
175 0.14
176 0.17
177 0.21
178 0.25
179 0.29
180 0.32
181 0.31
182 0.31
183 0.36
184 0.34
185 0.28
186 0.24
187 0.19
188 0.17
189 0.17
190 0.14
191 0.07
192 0.06
193 0.07
194 0.08
195 0.08
196 0.07
197 0.11
198 0.13
199 0.17
200 0.17
201 0.19
202 0.24
203 0.3
204 0.34
205 0.37
206 0.41
207 0.41
208 0.5
209 0.58
210 0.61
211 0.65
212 0.69
213 0.7
214 0.71
215 0.71
216 0.7
217 0.66
218 0.65
219 0.65
220 0.67
221 0.7
222 0.73
223 0.73
224 0.66
225 0.64
226 0.62
227 0.57
228 0.51
229 0.43
230 0.42
231 0.4
232 0.4
233 0.44
234 0.43
235 0.38
236 0.42
237 0.45
238 0.39
239 0.43
240 0.46
241 0.42
242 0.41
243 0.42
244 0.38
245 0.39
246 0.39
247 0.34
248 0.34