Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XCY0

Protein Details
Accession A0A0C9XCY0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-70CGLIHRCQRHRYKRQHWSYARPSPPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 6, E.R. 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFNLSSIQVLTPVAQPHIYAAVSAPMIFEPIPVLMVLYTGITIGACGLIHRCQRHRYKRQHWSYARPSPPPRIHMHLSPHLPLTPFRAYILNTYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.14
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.09
12 0.07
13 0.08
14 0.07
15 0.07
16 0.06
17 0.05
18 0.06
19 0.05
20 0.05
21 0.04
22 0.04
23 0.05
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.08
36 0.11
37 0.14
38 0.18
39 0.26
40 0.36
41 0.47
42 0.56
43 0.63
44 0.7
45 0.78
46 0.84
47 0.87
48 0.83
49 0.82
50 0.81
51 0.8
52 0.75
53 0.72
54 0.68
55 0.67
56 0.66
57 0.61
58 0.57
59 0.54
60 0.53
61 0.51
62 0.54
63 0.51
64 0.5
65 0.47
66 0.43
67 0.39
68 0.36
69 0.31
70 0.3
71 0.27
72 0.24
73 0.24
74 0.25
75 0.24