Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WKU6

Protein Details
Accession A0A0C9WKU6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-68SGLPRGARRKRSAKRSGKKPSLTNGTHydrophilic
NLS Segment(s)
PositionSequence
46-62PRGARRKRSAKRSGKKP
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR014722  Rib_L2_dom2  
Amino Acid Sequences MSAQNAPRSSLTSTQAIIDGPTTGVSCQSYRYKHLTLTPLTLSGLPRGARRKRSAKRSGKKPSLTNGTSQVGSRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.17
5 0.13
6 0.1
7 0.08
8 0.08
9 0.07
10 0.06
11 0.07
12 0.08
13 0.08
14 0.12
15 0.17
16 0.19
17 0.23
18 0.28
19 0.28
20 0.28
21 0.32
22 0.33
23 0.29
24 0.29
25 0.26
26 0.21
27 0.2
28 0.2
29 0.16
30 0.12
31 0.14
32 0.12
33 0.16
34 0.24
35 0.3
36 0.36
37 0.44
38 0.53
39 0.59
40 0.69
41 0.76
42 0.78
43 0.82
44 0.86
45 0.89
46 0.88
47 0.87
48 0.82
49 0.8
50 0.79
51 0.7
52 0.63
53 0.58
54 0.52
55 0.46
56 0.41