Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XDR3

Protein Details
Accession A0A0C9XDR3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
19-46GDMRRRLGGGRKRWRRGRRRLSGGSERVBasic
NLS Segment(s)
PositionSequence
22-40RRRLGGGRKRWRRGRRRLS
Subcellular Location(s) mito 10, cyto 8, extr 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MRGLGIYRGMLGIVRRLWGDMRRRLGGGRKRWRRGRRRLSGGSERVAELKQVIDEREQALDQRGSELENVLSGLKSSRKKWKRVLLDLVVSPRPLRHLVRIHGPLLFFGRRGSYLVLVDIGVRAVVLKVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.19
5 0.24
6 0.32
7 0.35
8 0.4
9 0.41
10 0.42
11 0.45
12 0.51
13 0.53
14 0.55
15 0.58
16 0.62
17 0.7
18 0.79
19 0.86
20 0.87
21 0.89
22 0.9
23 0.89
24 0.88
25 0.86
26 0.85
27 0.83
28 0.77
29 0.68
30 0.58
31 0.48
32 0.4
33 0.32
34 0.24
35 0.15
36 0.11
37 0.1
38 0.1
39 0.1
40 0.1
41 0.11
42 0.11
43 0.12
44 0.11
45 0.11
46 0.12
47 0.12
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.06
55 0.05
56 0.06
57 0.05
58 0.05
59 0.04
60 0.06
61 0.11
62 0.15
63 0.19
64 0.29
65 0.36
66 0.44
67 0.52
68 0.61
69 0.64
70 0.68
71 0.72
72 0.66
73 0.63
74 0.58
75 0.53
76 0.45
77 0.36
78 0.29
79 0.21
80 0.19
81 0.2
82 0.2
83 0.23
84 0.29
85 0.32
86 0.4
87 0.43
88 0.41
89 0.39
90 0.37
91 0.31
92 0.29
93 0.27
94 0.19
95 0.16
96 0.17
97 0.16
98 0.18
99 0.19
100 0.16
101 0.16
102 0.16
103 0.16
104 0.14
105 0.13
106 0.12
107 0.1
108 0.07
109 0.06
110 0.05