Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Y623

Protein Details
Accession A0A0C9Y623    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-38EEDREIRRCRCKGKEKGGKLRARKWKKEEYEBasic
NLS Segment(s)
PositionSequence
19-34KGKEKGGKLRARKWKK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
Amino Acid Sequences MVAQRSVEEDREIRRCRCKGKEKGGKLRARKWKKEEYEVVKLIEAKRIQGSLSGGTYGQTWTSIARDFLPIMASSVSKKDLNGEEILDSDVHADEIVTQADDFSWDQLLLRVLDGDEEDNIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.61
4 0.68
5 0.72
6 0.73
7 0.78
8 0.83
9 0.84
10 0.89
11 0.89
12 0.88
13 0.85
14 0.84
15 0.84
16 0.84
17 0.83
18 0.8
19 0.8
20 0.78
21 0.78
22 0.78
23 0.75
24 0.73
25 0.66
26 0.59
27 0.5
28 0.46
29 0.38
30 0.34
31 0.27
32 0.2
33 0.18
34 0.18
35 0.16
36 0.15
37 0.16
38 0.11
39 0.11
40 0.1
41 0.09
42 0.09
43 0.09
44 0.08
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.09
63 0.11
64 0.11
65 0.11
66 0.14
67 0.16
68 0.18
69 0.18
70 0.18
71 0.15
72 0.15
73 0.16
74 0.12
75 0.1
76 0.08
77 0.07
78 0.06
79 0.06
80 0.05
81 0.04
82 0.06
83 0.06
84 0.06
85 0.05
86 0.05
87 0.06
88 0.08
89 0.08
90 0.08
91 0.09
92 0.08
93 0.09
94 0.11
95 0.13
96 0.11
97 0.11
98 0.11
99 0.1
100 0.11
101 0.12
102 0.11