Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9XUQ4

Protein Details
Accession A0A0C9XUQ4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-79LGNGGRRTRKRTGCKPAPRSSLQHydrophilic
NLS Segment(s)
PositionSequence
51-68EKKGKGLGNGGRRTRKRT
Subcellular Location(s) cyto_mito 10.333, cyto 10, mito 9.5, cyto_nucl 8.833, nucl 6.5
Family & Domain DBs
Amino Acid Sequences ENAKSIGCRSEGGVAAAVQVAGTRRDETSGEFADIWWQLPDRATRLDRSVEKKGKGLGNGGRRTRKRTGCKPAPRSSLQETIGIVAEWEEGQRATTPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.13
5 0.08
6 0.07
7 0.07
8 0.07
9 0.09
10 0.1
11 0.1
12 0.12
13 0.13
14 0.15
15 0.18
16 0.18
17 0.18
18 0.17
19 0.16
20 0.18
21 0.17
22 0.15
23 0.11
24 0.1
25 0.09
26 0.1
27 0.12
28 0.11
29 0.15
30 0.16
31 0.17
32 0.19
33 0.23
34 0.26
35 0.3
36 0.37
37 0.38
38 0.38
39 0.38
40 0.4
41 0.38
42 0.34
43 0.34
44 0.31
45 0.35
46 0.4
47 0.45
48 0.5
49 0.5
50 0.55
51 0.59
52 0.62
53 0.63
54 0.66
55 0.72
56 0.73
57 0.81
58 0.84
59 0.84
60 0.82
61 0.76
62 0.72
63 0.67
64 0.64
65 0.54
66 0.48
67 0.39
68 0.33
69 0.3
70 0.23
71 0.17
72 0.11
73 0.1
74 0.07
75 0.07
76 0.07
77 0.06
78 0.08