Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WYU6

Protein Details
Accession A0A0C9WYU6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-81AEYHTPQRRTRPTTRPHRRRQRPTNCTSNYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MTGDEDPPAPPINANDGPAPLPTNADDGPHYHQGRRRLTTTAHHPPPAMTAEYHTPQRRTRPTTRPHRRRQRPTNCTSNYLGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.21
4 0.21
5 0.21
6 0.21
7 0.13
8 0.13
9 0.12
10 0.14
11 0.13
12 0.14
13 0.14
14 0.14
15 0.19
16 0.25
17 0.26
18 0.26
19 0.3
20 0.37
21 0.42
22 0.43
23 0.41
24 0.35
25 0.36
26 0.39
27 0.43
28 0.44
29 0.41
30 0.38
31 0.36
32 0.34
33 0.34
34 0.3
35 0.23
36 0.14
37 0.13
38 0.16
39 0.18
40 0.25
41 0.26
42 0.28
43 0.31
44 0.4
45 0.46
46 0.5
47 0.57
48 0.6
49 0.67
50 0.74
51 0.82
52 0.84
53 0.87
54 0.9
55 0.92
56 0.94
57 0.95
58 0.95
59 0.94
60 0.91
61 0.91
62 0.84
63 0.78