Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WVD1

Protein Details
Accession A0A0C9WVD1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25FLFPSLRKLCRRRYIPKNAFRPLDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 10.166, nucl 8, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MFLFPSLRKLCRRRYIPKNAFRPLDGPGLHVIHLEGLSLNNVKSSFPNPRARKRSSTRECSETQHLGTDCYHAKSEESRRFGDAGGCRTQGWQTLRFDKGPNSSDESGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.85
4 0.87
5 0.87
6 0.84
7 0.77
8 0.69
9 0.6
10 0.51
11 0.48
12 0.38
13 0.3
14 0.26
15 0.25
16 0.23
17 0.21
18 0.18
19 0.11
20 0.11
21 0.09
22 0.06
23 0.05
24 0.06
25 0.07
26 0.07
27 0.07
28 0.08
29 0.08
30 0.09
31 0.13
32 0.18
33 0.25
34 0.35
35 0.4
36 0.5
37 0.57
38 0.6
39 0.65
40 0.65
41 0.69
42 0.67
43 0.7
44 0.64
45 0.61
46 0.59
47 0.55
48 0.53
49 0.44
50 0.37
51 0.32
52 0.28
53 0.25
54 0.23
55 0.22
56 0.18
57 0.17
58 0.18
59 0.14
60 0.15
61 0.2
62 0.3
63 0.34
64 0.37
65 0.36
66 0.37
67 0.38
68 0.37
69 0.37
70 0.32
71 0.29
72 0.29
73 0.28
74 0.26
75 0.27
76 0.27
77 0.28
78 0.27
79 0.29
80 0.31
81 0.37
82 0.4
83 0.42
84 0.43
85 0.42
86 0.46
87 0.43
88 0.41
89 0.42