Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WBL2

Protein Details
Accession Q4WBL2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
358-384VWKSLYEDFRRRRKVCPKIRTIHTEYGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 4.5, cyto_nucl 4.5, golg 4, nucl 3.5, plas 2, pero 1, E.R. 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0000139  C:Golgi membrane  
GO:0005774  C:vacuolar membrane  
GO:0016757  F:glycosyltransferase activity  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
KEGG afm:AFUA_8G02690  -  
CDD cd06914  GT8_GNT1  
Amino Acid Sequences MGNKKATLLPYRRDSASSEADFFDIPDEPCLAIAKRQLRRIRTWIFFAVFIILILWFRREAPSPAPVSHIDYNKVDWSRYAYSQYATSSAYLCNAVMVFEALERLGSRADRVLFYPEDWDLFVADDHDRDSQLLVLAKEKYKALLVPISAEMIKAGGGSGESWDKSIAKLLAFGETEYDRVIHIDSDVTVLQSMDELFFLPPAKVAMPRAYWALPDTKTLSSLLIVIEPSYREFKALMESAQPALHGQVEVDSNETQRYDMELLNNRYADSALVLPHRQYGLVTGEFRKKDHRSFFGNDYETWDPDKVLAEAKLVHFSDWPLPKPWVLSNQKLLAEILPKCDFKPGTMQERGCRDREVWKSLYEDFRRRRKVCPKIRTIHTEYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.46
3 0.47
4 0.42
5 0.37
6 0.33
7 0.33
8 0.31
9 0.27
10 0.22
11 0.17
12 0.15
13 0.14
14 0.14
15 0.13
16 0.14
17 0.17
18 0.16
19 0.16
20 0.23
21 0.31
22 0.36
23 0.45
24 0.52
25 0.56
26 0.62
27 0.68
28 0.69
29 0.64
30 0.64
31 0.61
32 0.55
33 0.49
34 0.42
35 0.34
36 0.25
37 0.21
38 0.15
39 0.1
40 0.09
41 0.09
42 0.09
43 0.08
44 0.09
45 0.12
46 0.14
47 0.18
48 0.21
49 0.27
50 0.29
51 0.3
52 0.32
53 0.31
54 0.35
55 0.37
56 0.36
57 0.33
58 0.31
59 0.33
60 0.35
61 0.35
62 0.29
63 0.25
64 0.28
65 0.28
66 0.29
67 0.31
68 0.26
69 0.26
70 0.28
71 0.27
72 0.23
73 0.2
74 0.18
75 0.15
76 0.14
77 0.14
78 0.12
79 0.11
80 0.1
81 0.09
82 0.08
83 0.07
84 0.07
85 0.06
86 0.05
87 0.06
88 0.05
89 0.05
90 0.05
91 0.06
92 0.07
93 0.07
94 0.08
95 0.11
96 0.13
97 0.13
98 0.14
99 0.18
100 0.17
101 0.17
102 0.19
103 0.16
104 0.15
105 0.14
106 0.13
107 0.09
108 0.09
109 0.08
110 0.08
111 0.08
112 0.07
113 0.09
114 0.09
115 0.09
116 0.09
117 0.09
118 0.08
119 0.1
120 0.12
121 0.11
122 0.13
123 0.16
124 0.17
125 0.18
126 0.17
127 0.16
128 0.14
129 0.15
130 0.14
131 0.14
132 0.13
133 0.13
134 0.13
135 0.14
136 0.13
137 0.12
138 0.1
139 0.07
140 0.07
141 0.05
142 0.04
143 0.03
144 0.03
145 0.03
146 0.05
147 0.06
148 0.06
149 0.07
150 0.08
151 0.08
152 0.08
153 0.11
154 0.1
155 0.09
156 0.11
157 0.11
158 0.13
159 0.12
160 0.12
161 0.11
162 0.1
163 0.11
164 0.09
165 0.09
166 0.06
167 0.06
168 0.07
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.05
178 0.05
179 0.05
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.05
186 0.06
187 0.05
188 0.05
189 0.06
190 0.06
191 0.07
192 0.09
193 0.11
194 0.11
195 0.12
196 0.14
197 0.13
198 0.13
199 0.13
200 0.16
201 0.13
202 0.15
203 0.17
204 0.15
205 0.16
206 0.16
207 0.15
208 0.11
209 0.11
210 0.09
211 0.07
212 0.07
213 0.06
214 0.07
215 0.07
216 0.08
217 0.1
218 0.1
219 0.1
220 0.1
221 0.1
222 0.14
223 0.14
224 0.13
225 0.13
226 0.14
227 0.14
228 0.14
229 0.14
230 0.1
231 0.1
232 0.09
233 0.07
234 0.06
235 0.06
236 0.07
237 0.08
238 0.1
239 0.1
240 0.1
241 0.11
242 0.11
243 0.1
244 0.09
245 0.11
246 0.11
247 0.12
248 0.17
249 0.24
250 0.27
251 0.3
252 0.3
253 0.28
254 0.26
255 0.25
256 0.19
257 0.13
258 0.1
259 0.09
260 0.12
261 0.13
262 0.13
263 0.15
264 0.15
265 0.13
266 0.12
267 0.13
268 0.15
269 0.17
270 0.19
271 0.21
272 0.28
273 0.29
274 0.31
275 0.36
276 0.38
277 0.43
278 0.48
279 0.5
280 0.49
281 0.53
282 0.57
283 0.57
284 0.54
285 0.46
286 0.45
287 0.41
288 0.36
289 0.33
290 0.29
291 0.2
292 0.19
293 0.2
294 0.15
295 0.15
296 0.15
297 0.13
298 0.16
299 0.17
300 0.22
301 0.21
302 0.21
303 0.18
304 0.2
305 0.26
306 0.29
307 0.3
308 0.28
309 0.29
310 0.29
311 0.32
312 0.33
313 0.36
314 0.38
315 0.42
316 0.45
317 0.49
318 0.49
319 0.47
320 0.44
321 0.36
322 0.35
323 0.3
324 0.3
325 0.29
326 0.29
327 0.28
328 0.35
329 0.32
330 0.28
331 0.37
332 0.38
333 0.42
334 0.49
335 0.53
336 0.53
337 0.62
338 0.65
339 0.57
340 0.53
341 0.46
342 0.48
343 0.51
344 0.52
345 0.44
346 0.43
347 0.44
348 0.47
349 0.55
350 0.54
351 0.56
352 0.59
353 0.67
354 0.74
355 0.73
356 0.78
357 0.78
358 0.81
359 0.82
360 0.83
361 0.83
362 0.82
363 0.89
364 0.88