Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WMM8

Protein Details
Accession A0A0C9WMM8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
179-201ESAAAIRRHNLHRKQRHIVLPRFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 4, extr 4, E.R. 2, golg 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004923  FTR1/Fip1/EfeU  
Gene Ontology GO:0033573  C:high-affinity iron permease complex  
GO:0005381  F:iron ion transmembrane transporter activity  
Amino Acid Sequences MTFVMGVSMLKVDQEVDGESKAGKWVLFVLPLITVLKKAWKWLFFFTIYQFGSQSSTLSPDPYRLSALTPHAALTVFLIIMTMLLVVTGTSVFSKDAGEFEGNTYAKLLSDDTLGDEPGSYRVQGNVWHLACCSHGNNLDGQGQLIFGAIFGWSNNGSLGTISGILKFKEGRAKLFEKESAAAIRRHNLHRKQRHIVLPRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.1
4 0.11
5 0.11
6 0.12
7 0.11
8 0.13
9 0.13
10 0.11
11 0.1
12 0.12
13 0.13
14 0.14
15 0.14
16 0.13
17 0.12
18 0.13
19 0.14
20 0.11
21 0.1
22 0.1
23 0.16
24 0.16
25 0.23
26 0.27
27 0.3
28 0.33
29 0.36
30 0.4
31 0.35
32 0.37
33 0.32
34 0.33
35 0.3
36 0.27
37 0.23
38 0.2
39 0.19
40 0.18
41 0.16
42 0.1
43 0.13
44 0.12
45 0.15
46 0.14
47 0.15
48 0.17
49 0.17
50 0.18
51 0.15
52 0.16
53 0.17
54 0.2
55 0.18
56 0.17
57 0.16
58 0.14
59 0.14
60 0.13
61 0.1
62 0.07
63 0.05
64 0.05
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.07
85 0.07
86 0.07
87 0.08
88 0.12
89 0.12
90 0.12
91 0.12
92 0.1
93 0.1
94 0.1
95 0.1
96 0.05
97 0.06
98 0.06
99 0.07
100 0.08
101 0.08
102 0.07
103 0.06
104 0.06
105 0.08
106 0.09
107 0.07
108 0.07
109 0.08
110 0.09
111 0.11
112 0.14
113 0.19
114 0.19
115 0.19
116 0.19
117 0.19
118 0.19
119 0.19
120 0.17
121 0.13
122 0.15
123 0.15
124 0.16
125 0.18
126 0.19
127 0.17
128 0.16
129 0.12
130 0.1
131 0.09
132 0.09
133 0.06
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.05
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.07
146 0.07
147 0.06
148 0.08
149 0.08
150 0.11
151 0.12
152 0.12
153 0.14
154 0.15
155 0.17
156 0.25
157 0.26
158 0.28
159 0.33
160 0.37
161 0.39
162 0.43
163 0.43
164 0.37
165 0.37
166 0.35
167 0.34
168 0.33
169 0.33
170 0.31
171 0.35
172 0.39
173 0.46
174 0.54
175 0.58
176 0.66
177 0.72
178 0.78
179 0.81
180 0.83
181 0.84